PDB entry 6ith

View 6ith on RCSB PDB site
Description: structure of the transmembrane domain of syndecan 2 in micelles
Deposited on 2018-11-23, released 2019-02-27
The last revision was dated 2019-03-27, with a file datestamp of 2019-03-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Syndecan-2
    Species: Homo sapiens [TaxId:9606]
    Gene: SDC2, HSPG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P34741 (4-34)
      • initiating methionine (0)
      • expression tag (1-3)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6ithA (A:)
meqstevlaaviaggvigflfaiflilllvyrmrkhhhhhh

    Sequence, based on observed residues (ATOM records):
    >6ithA (A:)
meqstevlaaviaggvigflfaiflilllvyrmrk