PDB entry 6ita

View 6ita on RCSB PDB site
Description: Crystal structure of intracellular B30.2 domain of BTN3A1 mutant
Class: signaling protein
Keywords: Butyrophilin, SIGNALING PROTEIN
Deposited on 2018-11-20, released 2019-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-03, with a file datestamp of 2019-03-29.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Butyrophilin subfamily 3 member A1
    Species: Homo sapiens [TaxId:9606]
    Gene: BTN3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00481 (2-187)
      • expression tag (1)
      • engineered mutation (54)
      • engineered mutation (95)
      • expression tag (188-189)
    Domains in SCOPe 2.07: d6itaa1, d6itaa2, d6itaa3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6itaA (A:)
    mgaynewkkalfkpadvildpktanpillvsedqrsvqrakepqdlpdnperfnahycvl
    gcesfisgrhywevevgdrkewhigvcsknvqrkgavkmtpengfwtmgltdgnkyrtlt
    eprtnlklpkppkkvgvfldyetgdisfynavdgshihtfldvsfsealypvfriltlep
    talticpalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6itaA (A:)
    gaynewkkalfkpadvildpktanpillvsedqrsvqrakepqdlpdnperfnahycvlg
    cesfisgrhywevevgdrkewhigvcsknvqrkgavkmtpengfwtmgltdgnkyrtlte
    prtnlklpkppkkvgvfldyetgdisfynavdgshihtfldvsfsealypvfriltlept
    alticpale