PDB entry 6isq

View 6isq on RCSB PDB site
Description: structure of Lipase mutant with oxided Cys-His-Asp catalytic triad
Class: hydrolase
Keywords: Calb, HYDROLASE
Deposited on 2018-11-18, released 2019-07-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lipase b
    Species: Pseudozyma antarctica [TaxId:84753]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41365 (4-320)
      • expression tag (0-3)
      • engineered mutation (60)
      • engineered mutation (92)
      • engineered mutation (107-108)
      • engineered mutation (152)
      • engineered mutation (284-285)
    Domains in SCOPe 2.07: d6isqa1, d6isqa2
  • Chain 'B':
    Compound: lipase b
    Species: Pseudozyma antarctica [TaxId:84753]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41365 (4-320)
      • expression tag (0-3)
      • engineered mutation (60)
      • engineered mutation (92)
      • engineered mutation (107-108)
      • engineered mutation (152)
      • engineered mutation (284-285)
    Domains in SCOPe 2.07: d6isqb1, d6isqb2
  • Heterogens: CSD, ACT, IPA, EDO, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6isqA (A:)
    gamalpsgsdpafsqpksvldagltcqgaspssvskpillvpgtgttgpqsfdsnwipls
    aqlgytpcwispppfmlndtqvnteymvnaittlyagsgnnklpvltvcqgglvaqwglt
    ffpsirskvdrlmafapdykgtvlagpldalagsapsvwqqttgsalttalrnaggltqi
    vpttnlysatdeivqpqvsnspldssylfngknvqaqavcgplfvidhagsltsqfsyvv
    grsalrsttgqarsadygitdcnplpandltpeqkvaaaallapyyaaivagpkqncepd
    lmpyarpfavgkrtcsgivtp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6isqB (B:)
    gamalpsgsdpafsqpksvldagltcqgaspssvskpillvpgtgttgpqsfdsnwipls
    aqlgytpcwispppfmlndtqvnteymvnaittlyagsgnnklpvltvcqgglvaqwglt
    ffpsirskvdrlmafapdykgtvlagpldalagsapsvwqqttgsalttalrnaggltqi
    vpttnlysatdeivqpqvsnspldssylfngknvqaqavcgplfvidhagsltsqfsyvv
    grsalrsttgqarsadygitdcnplpandltpeqkvaaaallapyyaaivagpkqncepd
    lmpyarpfavgkrtcsgivtp