PDB entry 6isp

View 6isp on RCSB PDB site
Description: structure of Candida antarctica Lipase B mutant
Class: hydrolase
Keywords: calb, hydrolase
Deposited on 2018-11-18, released 2019-07-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lipase b
    Species: Pseudozyma antarctica [TaxId:84753]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41365 (4-End)
      • expression tag (2-3)
      • engineered mutation (60)
      • engineered mutation (92)
      • engineered mutation (107)
      • engineered mutation (152)
      • engineered mutation (284-285)
    Domains in SCOPe 2.07: d6ispa1, d6ispa2
  • Chain 'B':
    Compound: lipase b
    Species: Pseudozyma antarctica [TaxId:84753]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41365 (4-End)
      • expression tag (3)
      • engineered mutation (60)
      • engineered mutation (92)
      • engineered mutation (107)
      • engineered mutation (152)
      • engineered mutation (284-285)
    Domains in SCOPe 2.07: d6ispb1, d6ispb2
  • Chain 'C':
    Compound: lipase b
    Species: Pseudozyma antarctica [TaxId:84753]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41365 (4-320)
      • expression tag (2-3)
      • engineered mutation (60)
      • engineered mutation (92)
      • engineered mutation (107)
      • engineered mutation (152)
      • engineered mutation (284-285)
    Domains in SCOPe 2.07: d6ispc1, d6ispc2
  • Chain 'D':
    Compound: lipase b
    Species: Pseudozyma antarctica [TaxId:84753]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41365 (4-End)
      • expression tag (3)
      • engineered mutation (60)
      • engineered mutation (92)
      • engineered mutation (107)
      • engineered mutation (152)
      • engineered mutation (284-285)
    Domains in SCOPe 2.07: d6ispd1, d6ispd2
  • Heterogens: CPQ, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ispA (A:)
    gamalpsgsdpafsqpksvldagltcqgaspssvskpillvpgtgttgpqsfdsnwipls
    aqlgytpcwispppfmlndtqvnteymvnaittlyagsgnnklpvltvsqgglvaqwglt
    ffpsirskvdrlmafapdykgtvlagpldalagsapsvwqqttgsalttalrnaggltqi
    vpttnlysatdeivqpqvsnspldssylfngknvqaqavcgplfvidhagsltsqfsyvv
    grsalrsttgqarsadygitdcnplpandltpeqkvaaaallapyyaaivagpkqncepd
    lmpyarpfavgkrtcsgivtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ispA (A:)
    malpsgsdpafsqpksvldagltcqgaspssvskpillvpgtgttgpqsfdsnwiplsaq
    lgytpcwispppfmlndtqvnteymvnaittlyagsgnnklpvltvsqgglvaqwgltff
    psirskvdrlmafapdykgtvlagpldalagsapsvwqqttgsalttalrnaggltqivp
    ttnlysatdeivqpqvsnspldssylfngknvqaqavcgplfvidhagsltsqfsyvvgr
    salrsttgqarsadygitdcnplpandltpeqkvaaaallapyyaaivagpkqncepdlm
    pyarpfavgkrtcsgiv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ispB (B:)
    gamalpsgsdpafsqpksvldagltcqgaspssvskpillvpgtgttgpqsfdsnwipls
    aqlgytpcwispppfmlndtqvnteymvnaittlyagsgnnklpvltvsqgglvaqwglt
    ffpsirskvdrlmafapdykgtvlagpldalagsapsvwqqttgsalttalrnaggltqi
    vpttnlysatdeivqpqvsnspldssylfngknvqaqavcgplfvidhagsltsqfsyvv
    grsalrsttgqarsadygitdcnplpandltpeqkvaaaallapyyaaivagpkqncepd
    lmpyarpfavgkrtcsgivtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ispB (B:)
    alpsgsdpafsqpksvldagltcqgaspssvskpillvpgtgttgpqsfdsnwiplsaql
    gytpcwispppfmlndtqvnteymvnaittlyagsgnnklpvltvsqgglvaqwgltffp
    sirskvdrlmafapdykgtvlagpldalagsapsvwqqttgsalttalrnaggltqivpt
    tnlysatdeivqpqvsnspldssylfngknvqaqavcgplfvidhagsltsqfsyvvgrs
    alrsttgqarsadygitdcnplpandltpeqkvaaaallapyyaaivagpkqncepdlmp
    yarpfavgkrtcsgivt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6ispC (C:)
    gamalpsgsdpafsqpksvldagltcqgaspssvskpillvpgtgttgpqsfdsnwipls
    aqlgytpcwispppfmlndtqvnteymvnaittlyagsgnnklpvltvsqgglvaqwglt
    ffpsirskvdrlmafapdykgtvlagpldalagsapsvwqqttgsalttalrnaggltqi
    vpttnlysatdeivqpqvsnspldssylfngknvqaqavcgplfvidhagsltsqfsyvv
    grsalrsttgqarsadygitdcnplpandltpeqkvaaaallapyyaaivagpkqncepd
    lmpyarpfavgkrtcsgivtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ispC (C:)
    malpsgsdpafsqpksvldagltcqgaspssvskpillvpgtgttgpqsfdsnwiplsaq
    lgytpcwispppfmlndtqvnteymvnaittlyagsgnnklpvltvsqgglvaqwgltff
    psirskvdrlmafapdykgtvlagpldalagsapsvwqqttgsalttalrnaggltqivp
    ttnlysatdeivqpqvsnspldssylfngknvqaqavcgplfvidhagsltsqfsyvvgr
    salrsttgqarsadygitdcnplpandltpeqkvaaaallapyyaaivagpkqncepdlm
    pyarpfavgkrtcsgivtp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6ispD (D:)
    gamalpsgsdpafsqpksvldagltcqgaspssvskpillvpgtgttgpqsfdsnwipls
    aqlgytpcwispppfmlndtqvnteymvnaittlyagsgnnklpvltvsqgglvaqwglt
    ffpsirskvdrlmafapdykgtvlagpldalagsapsvwqqttgsalttalrnaggltqi
    vpttnlysatdeivqpqvsnspldssylfngknvqaqavcgplfvidhagsltsqfsyvv
    grsalrsttgqarsadygitdcnplpandltpeqkvaaaallapyyaaivagpkqncepd
    lmpyarpfavgkrtcsgivtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ispD (D:)
    alpsgsdpafsqpksvldagltcqgaspssvskpillvpgtgttgpqsfdsnwiplsaql
    gytpcwispppfmlndtqvnteymvnaittlyagsgnnklpvltvsqgglvaqwgltffp
    sirskvdrlmafapdykgtvlagpldalagsapsvwqqttgsalttalrnaggltqivpt
    tnlysatdeivqpqvsnspldssylfngknvqaqavcgplfvidhagsltsqfsyvvgrs
    alrsttgqarsadygitdcnplpandltpeqkvaaaallapyyaaivagpkqncepdlmp
    yarpfavgkrtcsgivt