PDB entry 6ise

View 6ise on RCSB PDB site
Description: Crystal structure of AMPPNP bound CK2 alpha from C. neoformans
Class: transferase
Keywords: Kinase, TRANSFERASE
Deposited on 2018-11-16, released 2019-11-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-20, with a file datestamp of 2019-11-15.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Casein kinase II subunit alpha
    Species: Cryptococcus neoformans var. grubii Bt85 [TaxId:1230076]
    Gene: C365_06417
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6isea_
  • Chain 'B':
    Compound: Casein kinase II subunit alpha
    Species: Cryptococcus neoformans var. grubii Bt85 [TaxId:1230076]
    Gene: C365_06417
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6iseb_
  • Heterogens: ANP, SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6iseA (A:)
    msggrsvarvyanvneklgrswwdydnlvvqwgvqdnyeivrkvgrgkysevfesihlpt
    dskcivkvlkpvkkkkikreikilqnlaggpnvvglldvvrdsqsktpsivteyvnntef
    ktlypkfsdfdvryyifellkaldfchskgimhrdvkphnvmidhekrtlrlidwglaef
    yhpgteynvrvasryfkgpellvdfqeydysldmwslgcmfasmifrkepffhghdnadq
    lvkiakvlgtdelytylerydidldaqfddilgryprkpwsrfvssenqryisseaidfl
    dkllrydhqerltaeeakehpyfepvrqaaaqasasqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6iseA (A:)
    rsvarvyanvneklgrswwdydnlvvqwgvqdnyeivrkvgrgkysevfesihlptdskc
    ivkvlkpvkkkkikreikilqnlaggpnvvglldvvrdsqsktpsivteyvnntefktly
    pkfsdfdvryyifellkaldfchskgimhrdvkphnvmidhekrtlrlidwglaefyhpg
    teynvrvasryfkgpellvdfqeydysldmwslgcmfasmifrkepffhghdnadqlvki
    akvlgtdelytylerydidldaqfddilgryprkpwsrfvssenqryisseaidfldkll
    rydhqerltaeeakehpyfepvrqaaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6iseB (B:)
    msggrsvarvyanvneklgrswwdydnlvvqwgvqdnyeivrkvgrgkysevfesihlpt
    dskcivkvlkpvkkkkikreikilqnlaggpnvvglldvvrdsqsktpsivteyvnntef
    ktlypkfsdfdvryyifellkaldfchskgimhrdvkphnvmidhekrtlrlidwglaef
    yhpgteynvrvasryfkgpellvdfqeydysldmwslgcmfasmifrkepffhghdnadq
    lvkiakvlgtdelytylerydidldaqfddilgryprkpwsrfvssenqryisseaidfl
    dkllrydhqerltaeeakehpyfepvrqaaaqasasqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6iseB (B:)
    rsvarvyanvneklgrswwdydnlvvqwgvqdnyeivrkvgrgkysevfesihlptdskc
    ivkvlkpvkkkkikreikilqnlaggpnvvglldvvrdsqsktpsivteyvnntefktly
    pkfsdfdvryyifellkaldfchskgimhrdvkphnvmidhekrtlrlidwglaefyhpg
    teynvrvasryfkgpellvdfqeydysldmwslgcmfasmifrkepffhghdnadqlvki
    akvlgtdelytylerydidldaqfddilgryprkpwsrfvssenqryisseaidfldkll
    rydhqerltaeeakehpyfepvrqaaa