PDB entry 6isc

View 6isc on RCSB PDB site
Description: complex structure of mCD226-ecto and hCD155-D1
Class: immune system
Keywords: complex structure; mCD226; CD155; NK cell receptor, IMMUNE SYSTEM
Deposited on 2018-11-16, released 2018-12-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-02.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: CD226 antigen
  Species: Mus musculus [TaxId:10090]
  Gene: Cd226, Pta1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8K4F0 (Start-222)
• Chain 'B':
  Compound: poliovirus receptor
  Species: Homo sapiens [TaxId:9606]
  Gene: PVR, PVS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P15151 (0-117)
  Domains in SCOPe 2.08: d6iscb_
• Heterogens: NAG, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6iscB (B:)
  dvvvqaptqvpgflgdsvtlpcylqvpnmevthvsqltwarhgesgsmavfhqtqgpsys
  eskrlefvaarlgaelrnaslrmfglrvedegnytclfvtfpqgsrsvdiwlrvlakp