PDB entry 6is4

View 6is4 on RCSB PDB site
Description: Crystal Structure of Staphylococcus aureus response regulator ArlR DNA binding domain
Class: DNA binding protein
Keywords: bacterial signaling, DNA BINDING PROTEIN
Deposited on 2018-11-15, released 2019-10-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-05-13, with a file datestamp of 2020-05-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Response regulator ArlR
    Species: Staphylococcus aureus [TaxId:273036]
    Gene: arlR, SAB1271c
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2YY03 (8-104)
      • expression tag (5-7)
    Domains in SCOPe 2.08: d6is4a1, d6is4a2
  • Heterogens: MG, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6is4A (A:)
mghhhhhhdiidvngitidknafkvtvngaeieltkteydllyllaenknhvmqreqiln
hvwgynsevetnvvdvyirylrnklkpydrdkmietvrgvgyvir

    Sequence, based on observed residues (ATOM records): (download) 
    >6is4A (A:)
hhhdiidvngitidknafkvtvngaeieltkteydllyllaenknhvmqreqilnhvwgy
nsevetnvvdvyirylrnklkpydrdkmietvrgvgyvir