PDB entry 6irr

View 6irr on RCSB PDB site
Description: solution structure of disc1/atf4 complex
Deposited on 2018-11-14, released 2019-09-25
The last revision was dated 2019-09-25, with a file datestamp of 2019-09-20.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Disrupted in schizophrenia 1 homolog,Cyclic AMP-dependent transcription factor ATF-4
    Species: Mus musculus [TaxId:10090]
    Gene: Atf4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q811T9 (0-87)
      • linker (88-96)
    • Uniprot Q06507 (97-132)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6irrA (A:)
gpwkedshivsaevgekceaigvkllhledqllgamyshdealfqslqgelqtvketlqa
milqlqptkeageasasyptagaqetealvprgsgfgknealkekadslakeiqylkdli
eevrkargkkrvp