PDB entry 6iri

View 6iri on RCSB PDB site
Description: Crystal structure of the minor ferredoxin from Thermosynechococcus elongatus
Class: electron transport
Keywords: photosynthesis, electron transport
Deposited on 2018-11-13, released 2019-09-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-11, with a file datestamp of 2019-12-06.
Experiment type: XRAY
Resolution: 1.38 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6iria_
  • Heterogens: SO4, FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6iriA (A:)
mtkrdhnkvynvtlvneerglnktirvhadeyildaaeaqgiplpyscragacvncagri
ikgtvdqsdhsflkpkeldagfvllcaayptsdcvistheednllnla

    Sequence, based on observed residues (ATOM records): (download) 
    >6iriA (A:)
tkrdhnkvynvtlvneerglnktirvhadeyildaaeaqgiplpyscragacvncagrii
kgtvdqsdhsflkpkeldagfvllcaayptsdcvistheednllnla