PDB entry 6ird

View 6ird on RCSB PDB site
Description: Complex structure of INADL PDZ89 and PLCb4 C-terminal CC-PBM
Class: hydrolase/protein binding
Keywords: PDZ supramodule, phospholipase C beta, HYDROLASE-PROTEIN BINDING complex
Deposited on 2018-11-12, released 2019-01-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-10-28, with a file datestamp of 2020-10-23.
Experiment type: XRAY
Resolution: 2.81 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase
    Species: Mus musculus [TaxId:10090]
    Gene: Plcb4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91UZ1 (Start-265)
      • engineered mutation (16)
      • engineered mutation (20)
      • engineered mutation (23-24)
      • engineered mutation (27)
      • engineered mutation (34-35)
      • engineered mutation (38)
  • Chain 'C':
    Compound: InaD-like protein
    Species: Homo sapiens [TaxId:9606]
    Gene: PATJ, INADL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6irdc1, d6irdc2
  • Heterogens: AU

PDB Chain Sequences:

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6irdC (C:)
    lsvdpatcpivpgqemiieiskgrsglglsivggkdtplnaivihevyeegaaardgrlw
    agdqilevngvdlrnssheeaitalrqtpqkvrlvvyrdeahyrdeenleifpvdlqkka
    grglglsivgkrngsgvfisdivkggaadldgrliqgdqilsvngedmrnasqetvatil
    kcaqglvqleigrlragswtsarttgggsggggsgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6irdC (C:)
    atcpivpgqemiieiskgrsglglsivggkdtplnaivihevyeegaaardgrlwagdqi
    levngvdlrnssheeaitalrqtpqkvrlvvyrleifpvdlqkkagrglglsivgkrngs
    gvfisdivkggaadldgrliqgdqilsvngedmrnasqetvatilkcaqglvqleigrlr