PDB entry 6ir8

View 6ir8 on RCSB PDB site
Description: rice wrky/dna complex
Deposited on 2018-11-12, released 2019-02-20
The last revision was dated 2019-07-10, with a file datestamp of 2019-07-05.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: OsWRKY45
  Species: Oryza sativa Japonica Group [TaxId:39947]
  Gene: OsJ_18062
  Database cross-references and differences (RAF-indexed):
  • Uniprot B9FNW2 (0-68)
• Chain 'B':
  Compound: DNA (5'-d(p*gp*ap*tp*ap*tp*tp*tp*gp*ap*cp*cp*gp*gp*a)-3')
  Species: synthetic construct, synthetic [TaxId:32630]
  
• Chain 'C':
  Compound: DNA (5'-d(p*tp*cp*cp*gp*gp*tp*cp*ap*ap*ap*tp*ap*tp*c)-3')
  Species: synthetic construct, synthetic [TaxId:32630]
  
• Heterogens: ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records:
  

  >6ir8A (A:)
  nsvvvknlddgqawrkygqkeiqnskhpkayfrcthkydqlctaqrqvqrcdddpasyrv
  tyigehtcr
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.