PDB entry 6ir2

View 6ir2 on RCSB PDB site
Description: Crystal structure of red fluorescent protein mCherry complexed with the nanobody LaM2 at 1.4 Angstron resolution
Class: fluorescent protein
Keywords: Complex, Nanobody, red fluorescent protein mCherry, LaM2, FLUORESCENT PROTEIN
Deposited on 2018-11-09, released 2019-11-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-11-13, with a file datestamp of 2019-11-08.
Experiment type: XRAY
Resolution: 1.39 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MCherry fluorescent protein
    Species: Anaplasma marginale [TaxId:770]
    Gene: mCherry
    Database cross-references and differences (RAF-indexed):
    • Uniprot X5DSL3 (Start-226)
      • chromophore (71)
    Domains in SCOPe 2.07: d6ir2a_
  • Chain 'B':
    Compound: mCherry's nanobody LaM2
    Species: Camelus bactrianus [TaxId:9837]
    Database cross-references and differences (RAF-indexed):
    • PDB 6IR2 (Start-126)
    Domains in SCOPe 2.07: d6ir2b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ir2A (A:)
    gmvskgeednmaiikefmrfkvhmegsvnghefeiegegegrpyegtqtaklkvtkggpl
    pfawdilspqfmygskayvkhpadipdylklsfpegfkwervmnfedggvvtvtqdsslq
    dgefiykvklrgtnfpsdgpvmqkktmgweassermypedgalkgeikqrlklkdgghyd
    aevkttykakkpvqlpgaynvniklditshnedytiveqyeraegrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ir2A (A:)
    maiikefmrfkvhmegsvnghefeiegegegrpyegtqtaklkvtkggplpfawdilspq
    fmygskayvkhpadipdylklsfpegfkwervmnfedggvvtvtqdsslqdgefiykvkl
    rgtnfpsdgpvmqkktmgweassermypedgalkgeikqrlklkdgghydaevkttykak
    kpvqlpgaynvniklditshnedytiveqyeraegrh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ir2B (B:)
    saqvqlvesggglvqaggslrlscatsgftfsdyamgwfrqapgkerefvaaiswsghvt
    dyadsvkgrftisrdnvkntvylqmnslkpedtavyscaaaksgtwwyqrsendfgswgq
    gtqvtvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ir2B (B:)
    vqlvesggglvqaggslrlscatsgftfsdyamgwfrqapgkerefvaaiswsghvtdya
    dsvkgrftisrdnvkntvylqmnslkpedtavyscaaaksgtwwyqrsendfgswgqgtq
    vtvs