PDB entry 6ir0

View 6ir0 on RCSB PDB site
Description: zinc finger domain of the human dtx protein
Deposited on 2018-11-09, released 2019-11-13
The last revision was dated 2020-01-29, with a file datestamp of 2020-01-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable E3 ubiquitin-protein ligase DTX2
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q86UW9 (0-75)
      • engineered mutation (35)
  • Heterogens: ZN

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6ir0A (A:)
nyteelkvppdedciicmeklstasgysdvtdskalgslavghltkcshafhllcllamy
cngnkdgslqcpsckt