PDB entry 6iqu

View 6iqu on RCSB PDB site
Description: Crystal structure of Prc with PDZ domain deletion in complex with NlpI
Class: hydrolase
Keywords: protein quality control, peptidoglycan remodeling, HYDROLASE
Deposited on 2018-11-08, released 2019-07-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-09-25, with a file datestamp of 2019-09-20.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipoprotein nlpI
    Species: Escherichia coli [TaxId:83333]
    Gene: nlpI, yhbM, b3163, JW3132
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6iqua_
  • Chain 'B':
    Compound: Tail-specific protease
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: prc, tsp, b1830, JW1819
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6iquA (A:)
    ghmsntswrksevlavplqptlqqevilarmeqilasraltdderaqllyergvlydslg
    lralarndfsqalairpdmpevfnylgiyltqagnfdaayeafdsvleldptynyahlnr
    gialyyggrdklaqddllafyqddpndpfrslwlylaeqkldekqakevlkqhfeksdke
    qwgwnivefylgniseqtlmerlkadatdntslaehlsetnfylgkyylslgdldsatal
    fklavannvhnfvehryallelsllgqdqddlaesdqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6iquA (A:)
    evlavplqptlqqevilarmeqilasraltdderaqllyergvlydslglralarndfsq
    alairpdmpevfnylgiyltqagnfdaayeafdsvleldptynyahlnrgialyyggrdk
    laqddllafyqddpndpfrslwlylaeqkldekqakevlkqhfeksdkeqwgwnivefyl
    gniseqtlmerlkadatdntslaehlsetnfylgkyylslgdldsatalfklavannvhn
    fvehryallelsllgqdqd
    

  • Chain 'B':
    No sequence available.