PDB entry 6ipz

View 6ipz on RCSB PDB site
Description: Fyn SH3 domain R96W mutant, crystallized with 18-crown-6
Class: protein binding
Keywords: kinase, SH3 domain, 18-crown-6, crown ether, PROTEIN BINDING
Deposited on 2018-11-05, released 2018-11-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-11-28, with a file datestamp of 2018-11-23.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'Z':
    Compound: Tyrosine-protein kinase Fyn
    Species: Homo sapiens [TaxId:9606]
    Gene: FYN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06241 (7-End)
      • expression tag (6)
      • engineered mutation (21)
    Domains in SCOPe 2.08: d6ipzz1, d6ipzz2
  • Heterogens: O4B, HOH

PDB Chain Sequences:

  • Chain 'Z':
    Sequence, based on SEQRES records: (download) 
    >6ipzZ (Z:)
llvprgstgvtlfvalydyeawteddlsfhkgekfqilnssegdwwearslttgetgyip
snyvapvdsi

    Sequence, based on observed residues (ATOM records): (download) 
    >6ipzZ (Z:)
stgvtlfvalydyeawteddlsfhkgekfqilnssegdwwearslttgetgyipsnyvap
vds