PDB entry 6ipx

View 6ipx on RCSB PDB site
Description: crystal structure of the apo form transcription factor
Deposited on 2018-11-05, released 2019-01-23
The last revision was dated 2019-02-06, with a file datestamp of 2019-02-01.
Experiment type: XRAY
Resolution: 2.63 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: AimR transcriptional regulator
    Species: Bacillus phage SPbeta [TaxId:66797]
    Gene: aimR, yopK
    Database cross-references and differences (RAF-indexed):
    • Uniprot O64094 (0-385)
      • expression tag (386-389)
  • Chain 'B':
    Compound: AimR transcriptional regulator
    Species: Bacillus phage SPbeta [TaxId:66797]
    Gene: aimR, yopK
    Database cross-references and differences (RAF-indexed):
    • Uniprot O64094 (Start-385)
      • expression tag (386-389)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6ipxA (A:)
    meliriamkkdlendnslmnkwatvaglknpnplydflnhdgktfnefssivnivksqyp
    dreyelmkdyclnldvktkaarsaleyadanmffeiedvlidsmiscsnmkskeygkvyk
    ihrelsnsvitefeavkrlgklniktpemnsfsrllllyhylstgnfspmaqlikqidls
    eisenmyirntyqtrvhvlmsniklnensleecreyskkalestnilrfqvfsyltigns
    llfsnyelaqenflkglsisvqnenynmifqqalcflnnvwrkenkwinfesdsimdlqe
    qahcfinfnenskakevldkldllvhndnelamhyylkgrleqnkacfyssieyfkksnd
    kflirlpllelqkmgenqkllellllleya
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6ipxB (B:)
    meliriamkkdlendnslmnkwatvaglknpnplydflnhdgktfnefssivnivksqyp
    dreyelmkdyclnldvktkaarsaleyadanmffeiedvlidsmiscsnmkskeygkvyk
    ihrelsnsvitefeavkrlgklniktpemnsfsrllllyhylstgnfspmaqlikqidls
    eisenmyirntyqtrvhvlmsniklnensleecreyskkalestnilrfqvfsyltigns
    llfsnyelaqenflkglsisvqnenynmifqqalcflnnvwrkenkwinfesdsimdlqe
    qahcfinfnenskakevldkldllvhndnelamhyylkgrleqnkacfyssieyfkksnd
    kflirlpllelqkmgenqkllellllleya
    

    Sequence, based on observed residues (ATOM records):
    >6ipxB (B:)
    liriamkkdlendnslmnkwatvaglknpnplydflnhdgktfnefssivnivksqypdr
    eyelmkdyclnldvktkaarsaleyadanmffeiedvlidsmiscsnmkskeygkvykih
    relsnsvitefeavkrlgklniktpemnsfsrllllyhylstgnfspmaqlikqidlsei
    senmyirntyqtrvhvlmsniklnensleecreyskkalestnilrfqvfsyltignsll
    fsnyelaqenflkglsisvqnenynmifqqalcflnnvwrkenkwinfesdsimdlqeqa
    hcfinfnenskakevldkldllvhndnelamhyylkgrleqnkacfyssieyfkksndkf
    lirlpllelqkmgenqkllellllleya