PDB entry 6ipt

View 6ipt on RCSB PDB site
Description: crystal structure of a fosfomycin and bleomycin resistant protein from anabaena/nostoc cyanobacterium at 1.70 a resolution
Deposited on 2018-11-04, released 2018-11-21
Made obsolete by 8he6 on 2022-11-30

The last revision was dated 2022-11-30, with a file datestamp of 2022-11-25.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: All3014 protein
  Species: Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) [TaxId:103690]
  Gene: all3014
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8YSS0 (0-119)
    • engineered mutation (30)
• Chain 'B':
  Compound: All3014 protein
  Species: Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) [TaxId:103690]
  Gene: all3014
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8YSS0 (0-119)
    • engineered mutation (30)
• Heterogens: CA, MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records:
  

  >6iptA (A:)
  mtislnhtivpahnkeasaqffaqifglnvssvghfaavrvndtltldfddretfeshhy
  afhvsdeefdtifarikqagleyssdpmhhnkgeinhrkggrgfyfydpnghnlelltls
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records:
  

  >6iptB (B:)
  mtislnhtivpahnkeasaqffaqifglnvssvghfaavrvndtltldfddretfeshhy
  afhvsdeefdtifarikqagleyssdpmhhnkgeinhrkggrgfyfydpnghnlelltls