PDB entry 6ipq

View 6ipq on RCSB PDB site
Description: Non-native ferritin 8-mer mutant-C90A/C102A/C130A
Class: oxidoreductase
Keywords: Ferritin, 24-mer, OXIDOREDUCTASE
Deposited on 2018-11-03, released 2019-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-13, with a file datestamp of 2019-03-08.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferritin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FTH1, FTH, FTHL6, OK/SW-cl.84, PIG15
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02794
      • conflict (85)
      • engineered mutation (89)
      • engineered mutation (101)
      • engineered mutation (129)
    Domains in SCOPe 2.07: d6ipqa_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ipqA (A:)
    ttastsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsh
    eerehaeklmklqnqrggriflqdiqkpdaddwesglnameaalhleknvnqsllelhkl
    atdkndphladfiethylikelgdhvtnlrkmgapesglaeylfdkhtlgdsdnes
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ipqA (A:)
    tsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheere
    haeklmklqnqrggriflqdiqkpdaddwesglnameaalhleknvnqsllelhklatdk
    ndphladfiethylikelgdhvtnlrkmgapesglaeylfdkhtlg