PDB entry 6ipp

View 6ipp on RCSB PDB site
Description: Non-native ferritin 8-mer mutant-C90A/C102A/C130A/D144C
Class: oxidoreductase
Keywords: ferritin, cysteine, OXIDOREDUCTASE
Deposited on 2018-11-03, released 2019-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-13, with a file datestamp of 2019-03-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferritin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FTH1, FTH, FTHL6, OK/SW-cl.84, PIG15
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02794
      • engineered mutation (89)
      • engineered mutation (101)
      • engineered mutation (129)
      • engineered mutation (143)
    Domains in SCOPe 2.07: d6ippa_
  • Chain 'B':
    Compound: ferritin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FTH1, FTH, FTHL6, OK/SW-cl.84, PIG15
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02794
      • engineered mutation (89)
      • engineered mutation (101)
      • engineered mutation (129)
      • engineered mutation (143)
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ippA (A:)
    ttastsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsh
    eerehaeklmklqnqrggriflqdikkpdaddwesglnameaalhleknvnqsllelhkl
    atdkndphladfiethylikelgchvtnlrkmgapesglaeylfdkhtlgdsdnes
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ippA (A:)
    qnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheerehaekl
    mklqnqrggriflqdikkpdaddwesglnameaalhleknvnqsllelhklatdkndphl
    adfiethylikelgchvtnlrkmgapesglaeylfdkhtlgd
    

  • Chain 'B':
    No sequence available.