PDB entry 6ip1

View 6ip1 on RCSB PDB site
Description: alpha-snap-snare subcomplex in the whole 20s complex
Deposited on 2018-11-01, released 2019-04-24
The last revision was dated 2019-11-06, with a file datestamp of 2019-11-01.
Experiment type: EM
Resolution: 3.9 Å
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vesicle-associated membrane protein 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Vamp2
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: syntaxin-1a
    Species: Rattus norvegicus [TaxId:10116]
    Gene: STX1A
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: synaptosomal-associated protein 25
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Snap25
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: synaptosomal-associated protein 25
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Snap25
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Alpha-soluble NSF attachment protein
    Species: Bos taurus [TaxId:9913]
    Gene: NAPA
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Alpha-soluble NSF attachment protein
    Species: Bos taurus [TaxId:9913]
    Gene: NAPA
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Alpha-soluble NSF attachment protein
    Species: Bos taurus [TaxId:9913]
    Gene: NAPA
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Alpha-soluble NSF attachment protein
    Species: Bos taurus [TaxId:9913]
    Gene: NAPA
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6ip1A (A:)
    gshmsataatvppaapageggppapppnltsnrrlqqtqaqvdevvdimrvnvdkvlerd
    qklselddradalqagasqfetsaaklkrkywwknlk
    

    Sequence, based on observed residues (ATOM records):
    >6ip1A (A:)
    tsnrrlqqtqaqvdevvdimrvnvdkvlerdqklselddradalqagasqfetsaaklkr
    kyw
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6ip1B (B:)
    gskdrtqelrtakdsdddddvtvtvdrdrfmdeffeqveeirgfidkiaenveevkrkhs
    ailaspnpdektkeeleelmsdikktankvrsklksieqsieqeeglnrssadlrirktq
    hstlsrkfvevmseynatqsdyrerckgriqrqleitgrtttseeledmlesgnpaifas
    giimdssiskqalseietrhseiiklensirelhdmfmdmamlvesqgemidrieynveh
    avdyveravsdtkk
    

    Sequence, based on observed residues (ATOM records):
    >6ip1B (B:)
    lseietrhseiiklensirelhdmfmdmamlvesqgemidrieynvehavdyveravsdt
    kk
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >6ip1C (C:)
    gsmaedadmrneleemqrradqladeslestrrmlqlveeskdagirtlvmldeqgeqle
    rieegmdqinkdmkeaeknltdlgkfcglcvcpcnklkssda
    

    Sequence, based on observed residues (ATOM records):
    >6ip1C (C:)
    radqladeslestrrmlqlveeskdagirtlvmldeqgeqlerieegmdqinkdmkeaek
    nltdl
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >6ip1D (D:)
    gsqmaisggfirrvtndarenemdenleqvsgiignlrhmaldmgneidtqnrqidrime
    kadsnktrideanqratkmlgsg
    

    Sequence, based on observed residues (ATOM records):
    >6ip1D (D:)
    arenemdenleqvsgiignlrhmaldmgneidtqnrqidrimekadsnktrideanqrat
    km
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >6ip1E (E:)
    gsmrgshhhhhhgsmdnsgkeaeamallaeaerkvknsqsffsglfggsskieeaceiya
    raanmfkmaknwsaagsafcqaaqlhlqlqskhdaatcfvdagnafkkadpqeainclmr
    aieiytdmgrftiaakhhisiaeiyetelvdiekaiahyeqsadyykgeesnssankcll
    kvagyaaqleqyqkaidiyeqvgtnamdspllkysakdyffkaalchfcidmlnaklavq
    kyeelfpafsdsrecklmkklleaheeqnvdsyteavkeydsisrldqwlttmllrikkt
    iqgdeedlr
    

    Sequence, based on observed residues (ATOM records):
    >6ip1E (E:)
    sgkeaeamallaeaerkvknsqsffsglfggsskieeaceiyaraanmfkmaknwsaags
    afcqaaqlhlqlqskhdaatcfvdagnafkkadpqeainclmraieiytdmgrftiaakh
    hisiaeiyetelvdiekaiahyeqsadyykgeesnssankcllkvagyaaqleqyqkaid
    iyeqvgtnamdspllkysakdyffkaalchfcidmlnaklavqkyeelfpafsdsreckl
    mkklleaheeqnvdsyteavkeydsisrldqwlttmllrikktiqgdeedlr
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >6ip1F (F:)
    gsmrgshhhhhhgsmdnsgkeaeamallaeaerkvknsqsffsglfggsskieeaceiya
    raanmfkmaknwsaagsafcqaaqlhlqlqskhdaatcfvdagnafkkadpqeainclmr
    aieiytdmgrftiaakhhisiaeiyetelvdiekaiahyeqsadyykgeesnssankcll
    kvagyaaqleqyqkaidiyeqvgtnamdspllkysakdyffkaalchfcidmlnaklavq
    kyeelfpafsdsrecklmkklleaheeqnvdsyteavkeydsisrldqwlttmllrikkt
    iqgdeedlr
    

    Sequence, based on observed residues (ATOM records):
    >6ip1F (F:)
    sgkeaeamallaeaerkvknsqsffsglfggsskieeaceiyaraanmfkmaknwsaags
    afcqaaqlhlqlqskhdaatcfvdagnafkkadpqeainclmraieiytdmgrftiaakh
    hisiaeiyetelvdiekaiahyeqsadyykgeesnssankcllkvagyaaqleqyqkaid
    iyeqvgtnamdspllkysakdyffkaalchfcidmlnaklavqkyeelfpafsdsreckl
    mkklleaheeqnvdsyteavkeydsisrldqwlttmllrikktiqgdeedlr
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >6ip1G (G:)
    gsmrgshhhhhhgsmdnsgkeaeamallaeaerkvknsqsffsglfggsskieeaceiya
    raanmfkmaknwsaagsafcqaaqlhlqlqskhdaatcfvdagnafkkadpqeainclmr
    aieiytdmgrftiaakhhisiaeiyetelvdiekaiahyeqsadyykgeesnssankcll
    kvagyaaqleqyqkaidiyeqvgtnamdspllkysakdyffkaalchfcidmlnaklavq
    kyeelfpafsdsrecklmkklleaheeqnvdsyteavkeydsisrldqwlttmllrikkt
    iqgdeedlr
    

    Sequence, based on observed residues (ATOM records):
    >6ip1G (G:)
    sgkeaeamallaeaerkvknsqsffsglfggsskieeaceiyaraanmfkmaknwsaags
    afcqaaqlhlqlqskhdaatcfvdagnafkkadpqeainclmraieiytdmgrftiaakh
    hisiaeiyetelvdiekaiahyeqsadyykgeesnssankcllkvagyaaqleqyqkaid
    iyeqvgtnamdspllkysakdyffkaalchfcidmlnaklavqkyeelfpafsdsreckl
    mkklleaheeqnvdsyteavkeydsisrldqwlttmllrikktiqgdeedlr
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >6ip1H (H:)
    gsmrgshhhhhhgsmdnsgkeaeamallaeaerkvknsqsffsglfggsskieeaceiya
    raanmfkmaknwsaagsafcqaaqlhlqlqskhdaatcfvdagnafkkadpqeainclmr
    aieiytdmgrftiaakhhisiaeiyetelvdiekaiahyeqsadyykgeesnssankcll
    kvagyaaqleqyqkaidiyeqvgtnamdspllkysakdyffkaalchfcidmlnaklavq
    kyeelfpafsdsrecklmkklleaheeqnvdsyteavkeydsisrldqwlttmllrikkt
    iqgdeedlr
    

    Sequence, based on observed residues (ATOM records):
    >6ip1H (H:)
    sgkeaeamallaeaerkvknsqsffsglfggsskieeaceiyaraanmfkmaknwsaags
    afcqaaqlhlqlqskhdaatcfvdagnafkkadpqeainclmraieiytdmgrftiaakh
    hisiaeiyetelvdiekaiahyeqsadyykgeesnssankcllkvagyaaqleqyqkaid
    iyeqvgtnamdspllkysakdyffkaalchfcidmlnaklavqkyeelfpafsdsreckl
    mkklleaheeqnvdsyteavkeydsisrldqwlttmllrikktiqgdeedlr