PDB entry 6ioc

View 6ioc on RCSB PDB site
Description: the structure of the h109q mutant of udgx in complex with uracil
Deposited on 2018-10-29, released 2019-07-24
The last revision was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.62 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phage SPO1 DNA polymerase-related protein
    Species: Mycobacterium smegmatis MC2 155 [TaxId:246196]
    Gene: MSMEI_0259
    Database cross-references and differences (RAF-indexed):
    • Uniprot I7F541 (3-211)
      • expression tag (0-2)
      • engineered mutation (111)
  • Heterogens: URA, SF4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6iocA (A:)
gshmagaqdfvphtadlaelaaaagecrgcglyrdatqavfgaggrsarimmigeqpgdk
edlaglpfvgpagrlldraleaadidrdalyvtnavkhfkftraaggkrriqktpsrtev
vacrpwliaemtsvepdvvvllgataakallgndfrvtqhrgevlhvddvpgdpalvatv
hpssllrgpkeeresafaglvddlrvaadvrp