PDB entry 6ins

View 6ins on RCSB PDB site
Description: x-ray analysis of the single chain b29-a1 peptide-linked insulin molecule. a completely inactive analogue
Deposited on 1992-11-25, released 1994-01-31
The last revision prior to the SCOP 1.55 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2 Å
R-factor: 0.179
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Domains in SCOP 1.55: d6inse_
  • Chain 'F':
    Domains in SCOP 1.55: d6insf_

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6insE (E:)
fvnqhlcgshlvealylvcgergffytpkgiveqcctsicslyqlenycn

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6insF (F:)
fvnqhlcgshlvealylvcgergffytpkgiveqcctsicslyqlenycn