PDB entry 6in1

View 6in1 on RCSB PDB site
Description: crystal structure of the first bromodomain of brd4 in complex with 18- crown-6
Deposited on 2018-10-24, released 2019-10-30
The last revision was dated 2019-10-30, with a file datestamp of 2019-10-25.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain-containing protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene: BRD4, HUNK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60885 (8-End)
      • expression tag (5-7)
  • Heterogens: LOC, O4B, NA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6in1A (A:)
mhhhhhhmstnppppetsnpnkpkrqtnqlqyllrvvlktlwkhqfawpfqqpvdavkln
lpdyykiiktpmdmgtikkrlennyywnaqeciqdfntmftncyiynkpgddivlmaeal
eklflqkinelptee

    Sequence, based on observed residues (ATOM records):
    >6in1A (A:)
hhmstnppppetsnpnkpkrqtnqlqyllrvvlktlwkhqfawpfqqpvdavklnlpdyy
kiiktpmdmgtikkrlennyywnaqeciqdfntmftncyiynkpgddivlmaealeklfl
qkinelpt