PDB entry 6imz

View 6imz on RCSB PDB site
Description: Crystal structure of MTH1 in complex with 18-Crown-6
Class: hydrolase
Keywords: Human Nudix Hydrolase, 8-oxo-dGTP, cancer, HYDROLASE
Deposited on 2018-10-24, released 2019-10-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-10-30, with a file datestamp of 2019-10-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 7,8-dihydro-8-oxoguanine triphosphatase
    Species: Homo sapiens [TaxId:9606]
    Gene: NUDT1, MTH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36639 (1-154)
      • expression tag (155-162)
    Domains in SCOPe 2.07: d6imza1, d6imza2
  • Heterogens: ZN, SO4, O4B, VGH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6imzA (A:)
    masrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgarrelqeesgltv
    dalhkvgqivfefvgepelmdvhvfctdsiqgtpvesdemrpcwfqldqipfkdmwpdds
    ywfplllqkkkfhgyfkfqgqdtildytlrevdtvlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6imzA (A:)
    asrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgarrelqeesgltvd
    alhkvgqivfefvgepelmdvhvfctdsiqgtpvesdemrpcwfqldqipfkdmwpddsy
    wfplllqkkkfhgyfkfqgqdtildytlrevdtvlehhhhhh