PDB entry 6imx

View 6imx on RCSB PDB site
Description: Crystal structure of V30M mutated transthyretin in complex with 18-Crown-6
Class: transport protein
Keywords: transthyretin, amyloid, t4-binding protein, transport protein
Deposited on 2018-10-24, released 2019-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-13, with a file datestamp of 2019-03-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered mutation (61)
    Domains in SCOPe 2.07: d6imxa_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered mutation (61)
    Domains in SCOPe 2.07: d6imxb_
  • Heterogens: O4B, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6imxA (A:)
    mrgshhhhhhgsmashrllllclaglvfvseagptgtgeskcplmvkvldavrgspainv
    amhvfrkaaddtwepfasgktsesgelhgltteeefvegiykveidtksywkalgispfh
    ehaevvftandsgprrytiaallspysysttavvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >6imxA (A:)
    cplmvkvldavrgspainvamhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6imxB (B:)
    mrgshhhhhhgsmashrllllclaglvfvseagptgtgeskcplmvkvldavrgspainv
    amhvfrkaaddtwepfasgktsesgelhgltteeefvegiykveidtksywkalgispfh
    ehaevvftandsgprrytiaallspysysttavvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >6imxB (B:)
    cplmvkvldavrgspainvamhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn