PDB entry 6imq

View 6imq on RCSB PDB site
Description: crystal structure of pml b1-box multimers
Deposited on 2018-10-23, released 2019-07-31
The last revision was dated 2019-09-04, with a file datestamp of 2019-08-30.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein PML
    Species: Homo sapiens [TaxId:9606]
    Gene: PML
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29590 (2-End)
      • expression tag (1)
  • Chain 'B':
    Compound: Protein PML
    Species: Homo sapiens [TaxId:9606]
    Gene: PML
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29590 (2-50)
      • expression tag (1)
  • Chain 'C':
    Compound: Protein PML
    Species: Homo sapiens [TaxId:9606]
    Gene: PML
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29590 (2-End)
      • expression tag (1)
  • Chain 'D':
    Compound: Protein PML
    Species: Homo sapiens [TaxId:9606]
    Gene: PML
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29590 (2-End)
      • expression tag (1)
  • Heterogens: ZN, CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6imqA (A:)
gsrqivdaqavctrckesadfwcfeceqllcakcfeahqwflkhearplae

    Sequence, based on observed residues (ATOM records):
    >6imqA (A:)
srqivdaqavctrckesadfwcfeceqllcakcfeahqwflkhearpla

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6imqB (B:)
gsrqivdaqavctrckesadfwcfeceqllcakcfeahqwflkhearplae

    Sequence, based on observed residues (ATOM records):
    >6imqB (B:)
srqivdaqavctrckesadfwcfeceqllcakcfeahqwflkhearplae

  • Chain 'C':
    Sequence, based on SEQRES records:
    >6imqC (C:)
gsrqivdaqavctrckesadfwcfeceqllcakcfeahqwflkhearplae

    Sequence, based on observed residues (ATOM records):
    >6imqC (C:)
srqivdaqavctrckesadfwcfeceqllcakcfeahqwflkhearpla

  • Chain 'D':
    Sequence, based on SEQRES records:
    >6imqD (D:)
gsrqivdaqavctrckesadfwcfeceqllcakcfeahqwflkhearplae

    Sequence, based on observed residues (ATOM records):
    >6imqD (D:)
srqivdaqavctrckesadfwcfeceqllcakcfeahqwflkhearpla