PDB entry 6ima

View 6ima on RCSB PDB site
Description: crystal structure of alkbh1 without alpha-1 (n37-c369)
Deposited on 2018-10-22, released 2020-01-22
The last revision was dated 2020-04-08, with a file datestamp of 2020-04-03.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleic acid dioxygenase ALKBH1
    Species: Mus musculus [TaxId:10090]
    Gene: Alkbh1, Abh, Alkbh
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Nucleic acid dioxygenase ALKBH1
    Species: Mus musculus [TaxId:10090]
    Gene: Alkbh1, Abh, Alkbh
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Nucleic acid dioxygenase ALKBH1
    Species: Mus musculus [TaxId:10090]
    Gene: Alkbh1, Abh, Alkbh
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CIT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6imaA (A:)
    gptadlgavidfseahlarspkpgvpqvvrfplnvssvterdaervglepvskwraygle
    gypgfifipnpflpgcqrhwvkqclklysqkpnvcnldkhmtkeetqglweqskevlrsk
    evtkrrprsllerlrwvtlgyhynwdskkysadhytpfpsdlaflseqvatacgfqgfqa
    eagilnyyrldstlgihvdrseldhskpllsfsfgqsaifllgglkrdeaptamfmhsgd
    imvmsgfsrllnhavprvlphpdgeclphcletplpavlpsnslvepcsvedwqvcatyl
    rtarvnmtvrqvlatgqdfplepveetkrdiaadg
    

    Sequence, based on observed residues (ATOM records):
    >6imaA (A:)
    adlgavidfsegvpqvvrfplnvssvterdaervglepvskwrayglegypgfifipnpf
    lpgcqrhwvkqclklysqkpnvcnldkhmtkeetqglweqskevlrskevtkrrprslle
    rlrwvtlgyhynwdskkysadhytpfpsdlaflseqvatacgfqgfqaeagilnyyrlds
    tlgihldhskpllsfsfgqsaifllgglkrdeaptamfmhsgdimvmsgfsrllnhavpr
    vlphpdgeclphcletplpavlpsnslvepcsvedwqvcatylrtarvnmtvrqvla
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6imaB (B:)
    gptadlgavidfseahlarspkpgvpqvvrfplnvssvterdaervglepvskwraygle
    gypgfifipnpflpgcqrhwvkqclklysqkpnvcnldkhmtkeetqglweqskevlrsk
    evtkrrprsllerlrwvtlgyhynwdskkysadhytpfpsdlaflseqvatacgfqgfqa
    eagilnyyrldstlgihvdrseldhskpllsfsfgqsaifllgglkrdeaptamfmhsgd
    imvmsgfsrllnhavprvlphpdgeclphcletplpavlpsnslvepcsvedwqvcatyl
    rtarvnmtvrqvlatgqdfplepveetkrdiaadg
    

    Sequence, based on observed residues (ATOM records):
    >6imaB (B:)
    tadlgavidfseavpqvvrfplnvssvterdaervglepvskwrayglegypgfifipnp
    flpgcqrhwvkqclklysqkpnvcnldkhmtkeetqglweqskevlrprsllerlrwvtl
    gyhynwdskkysadhytpfpsdlaflseqvatacgfqgfqaeagilnyyrldhskpllsf
    sfgqsaifllgglkrdeaptamfmhsgdimvmsgfsrllnhavprvlphpdgeclphcle
    tplpavlpsnslvepcsvedwqvcatylrtarvnmtvrqvlatg
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >6imaC (C:)
    gptadlgavidfseahlarspkpgvpqvvrfplnvssvterdaervglepvskwraygle
    gypgfifipnpflpgcqrhwvkqclklysqkpnvcnldkhmtkeetqglweqskevlrsk
    evtkrrprsllerlrwvtlgyhynwdskkysadhytpfpsdlaflseqvatacgfqgfqa
    eagilnyyrldstlgihvdrseldhskpllsfsfgqsaifllgglkrdeaptamfmhsgd
    imvmsgfsrllnhavprvlphpdgeclphcletplpavlpsnslvepcsvedwqvcatyl
    rtarvnmtvrqvlatgqdfplepveetkrdiaadg
    

    Sequence, based on observed residues (ATOM records):
    >6imaC (C:)
    adlgavidfsevpqvvrfplnvssvterdaervglepvskwrayglegypgfifipnpfl
    pgcqrhwvkqclklysqkpnvcnldkhmtkeetqglweqskevlrskeprsllerlrwvt
    lgyhydskkysadhytpfpsdlaflseqvatacgfqgfqaeagilnyyrldhskpllsfs
    fgqsaifllgglkrdeaptamfmhsgdimvmsgfsrllnhavprvlphpdgeclphclet
    plpavlpsnslvepcsvedwqvcatylrtarvnmtvrqvlat