PDB entry 6ili

View 6ili on RCSB PDB site
Description: Crystal structure of human MTH1(G2K/D120N mutant) in complex with 8-oxo-dGTP at pH 6.5
Class: hydrolase
Keywords: alpha-beta-alpha sandwich, hydrolase, DNA damage, DNA repair, DNA replication
Deposited on 2018-10-18, released 2018-11-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-11-07, with a file datestamp of 2018-11-02.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 7,8-dihydro-8-oxoguanine triphosphatase
  Species: Homo sapiens [TaxId:9606]
  Gene: NUDT1, MTH1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P36639 (0-155)
    • engineered mutation (1)
    • engineered mutation (119)
  Domains in SCOPe 2.08: d6ilia_
• Chain 'B':
  Compound: 7,8-dihydro-8-oxoguanine triphosphatase
  Species: Homo sapiens [TaxId:9606]
  Gene: NUDT1, MTH1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P36639 (0-155)
    • engineered mutation (1)
    • engineered mutation (119)
  Domains in SCOPe 2.08: d6ilib_
• Heterogens: 8DG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6iliA (A:)
  mkasrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgarrelqeesglt
  vdalhkvgqivfefvgepelmdvhvfctdsiqgtpvesdemrpcwfqldqipfkdmwpdn
  sywfplllqkkkfhgyfkfqgqdtildytlrevdtv
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6iliB (B:)
  mkasrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgarrelqeesglt
  vdalhkvgqivfefvgepelmdvhvfctdsiqgtpvesdemrpcwfqldqipfkdmwpdn
  sywfplllqkkkfhgyfkfqgqdtildytlrevdtv