PDB entry 6ilg

View 6ilg on RCSB PDB site
Description: crystal structure of bat mhc class i ptal-n*01:01 for 2.6 angstrom
Deposited on 2018-10-18, released 2019-07-24
The last revision was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MHC class I antigen
    Species: Pteropus alecto [TaxId:9402]
    Gene: Ptal-N
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: Pteropus alecto [TaxId:9402]
    Gene: PAL_GLEAN10023531
    Database cross-references and differences (RAF-indexed):
    • PDB 6ILG (0-97)
  • Chain 'C':
    Compound: hev-1-p8l
    Species: HENDRA VIRUS, synthetic [TaxId:63330]
    Database cross-references and differences (RAF-indexed):
    • PDB 6ILG (0-7)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6ilgA (A:)
gfhslryfytawsrpgsgeprfvavgyvddtqfvrfdsdnaspraeprapwmdlveqqdp
qywdrntrnardaaqtyrvgldnvrgyynqseagshtiqrmygcdvgphgrllrgydqla
ydgadyialnedlrswtaadlaaqntrrkweeagyaerdraylegecvewllkhlengre
tllradppkthithhpisdrevtlrcwalgfypeeitltwqhdgedqtqemelvetrpdg
ngafqkwaalvvpsgeeqrytchvqheglpqpltlrwep

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6ilgB (B:)
eprtpkiqvysrhpaengkpnylncyvygfhppqieidllkngqkmkteqsdlsfskdws
fyllvhtdftpstvdeyscrvnhsslaaphmvkwdrnn

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >6ilgC (C:)
dfantfll