PDB entry 6ile

View 6ile on RCSB PDB site
Description: crystal structure of a mutant ptal-n*01:01 for 2.9 angstrom, 52m 53d 54l deleted
Deposited on 2018-10-17, released 2019-07-24
The last revision was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MHC class I antigen
    Species: Pteropus alecto [TaxId:9402]
    Gene: Ptal-N
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: Pteropus alecto [TaxId:9402]
    Gene: PAL_GLEAN10023531
    Database cross-references and differences (RAF-indexed):
    • PDB 6ILE (0-97)
  • Chain 'C':
    Compound: hev-1
    Species: HENDRA VIRUS, synthetic [TaxId:63330]
    Database cross-references and differences (RAF-indexed):
    • PDB 6ILE (0-7)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6ileA (A:)
gfhslryfytawsrpgsgeprfvavgyvddtqfvrfdsdnaspraeprapwveqqdpqyw
drntrnardaaqtyrvgldnvrgyynqseagshtiqrmygcdvgphgrllrgydqlaydg
adyialnedlrswtaadlaaqntrrkweeagyaerdraylegecvewllkhlengretll
radppkthithhpisdrevtlrcwalgfypeeitltwqhdgedqtqemelvetrpdgnga
fqkwaalvvpsgeeqrytchvqheglpqpltlrwep

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6ileB (B:)
eprtpkiqvysrhpaengkpnylncyvygfhppqieidllkngqkmkteqsdlsfskdws
fyllvhtdftpstvdeyscrvnhsslaaphmvkwdrnn

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >6ileC (C:)
dfantflp