PDB entry 6il7

View 6il7 on RCSB PDB site
Description: structure of enterococcus faecalis (v583) alkylhydroperoxide reductase subunit f (ahpf) c503a mutant
Deposited on 2018-10-17, released 2019-05-22
The last revision was dated 2019-05-22, with a file datestamp of 2019-05-17.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thioredoxin reductase/glutathione-related protein
    Species: Enterococcus faecalis V583 [TaxId:226185]
    Gene: EF_2738
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q830N9 (0-207)
      • engineered mutation (150)
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6il7A (A:)
qwfpesmrqqlsgifakltkkvtllqfldasdekslelqsfltefasldqkitletilkd
tepakellygiekmpsvvlldaagnytgikfsgipsghevnslvlavynvgsegqpleas
lqknilalpkrkieifvsltchfcpdvvaaaqriasinphveaemvdislfpelkkekki
msvpamlidgeqmifgsktmteiieala