PDB entry 6il0

View 6il0 on RCSB PDB site
Description: K3U complex structure of peptide deformylase from Xanthomonas oryzae pv. oryzae
Class: hydrolase
Keywords: peptide deformylase, hydrolase
Deposited on 2018-10-16, released 2019-10-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-23, with a file datestamp of 2019-10-18.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptide deformylase
    Species: Xanthomonas oryzae pv. oryzae KACC10331 [TaxId:291331]
    Gene: def, XOO1075
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6il0a_
  • Heterogens: K3U, NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6il0A (A:)
    mirdiirmgdkrllrvapqvtnlgsaelhalvsdmfetmgaahgvglaapqiavdlqlmv
    fgfeaserypeapavpltalanaqieplsdemengwegclsipglravipryryiryrgf
    apdgspiereaegfharvvqheydhlvgrlypsrienfdtfgfddvlsy
    

    Sequence, based on observed residues (ATOM records): (download)
    >6il0A (A:)
    mirdiirmgdkrllrvapqvtnlgsaelhalvsdmfetmgaahgvglaapqiavdlqlmv
    fgfpavpltalanaqieplsdemengwegclsipglravipryryiryrgfapdgspier
    eaegfharvvqheydhlvgrlypsrienfdtfgfddvlsy