PDB entry 6ik4

View 6ik4 on RCSB PDB site
Description: a novel m23 metalloprotease pseudoalterin from deep-sea
Deposited on 2018-10-14, released 2019-10-16
The last revision was dated 2020-04-29, with a file datestamp of 2020-04-24.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elastinolytic metalloprotease
    Species: Pseudoalteromonas sp. CF6-2 [TaxId:562716]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6ik4A (A:)
atftmnlpwsqgyywysggahsntgsgypyssldfnngsggwgsntpwvqaahggvitrf
sscnirvthssgfatnyyhmsnlqynngdtvqpgtllgryansynqalceggqssgphvh
ftllqngqqvslhnryisnyridvgnsnydsncnnfyferngrrtcawrplyr