PDB entry 6ijy

View 6ijy on RCSB PDB site
Description: Crystal structure of human MTH1(G2K/C87A/C104S mutant) in complex with 8-oxo-dGTP determined using a crystal obtained under microgravity
Class: hydrolase
Keywords: alpha-beta-alpha sandwich, hydrolase, DNA damage, DNA repair, DNA replication
Deposited on 2018-10-12, released 2019-02-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-02-20, with a file datestamp of 2019-02-15.
Experiment type: XRAY
Resolution: 1.04 Å
R-factor: N/A
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 7,8-dihydro-8-oxoguanine triphosphatase
  Species: Homo sapiens [TaxId:9606]
  Gene: NUDT1, MTH1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P36639 (0-155)
    • engineered mutation (1)
    • engineered mutation (86)
    • engineered mutation (103)
  Domains in SCOPe 2.08: d6ijya_
• Chain 'B':
  Compound: 7,8-dihydro-8-oxoguanine triphosphatase
  Species: Homo sapiens [TaxId:9606]
  Gene: NUDT1, MTH1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P36639 (0-155)
    • engineered mutation (1)
    • engineered mutation (86)
    • engineered mutation (103)
  Domains in SCOPe 2.08: d6ijyb_
• Heterogens: 8DG, NA, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6ijyA (A:)
  mkasrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgarrelqeesglt
  vdalhkvgqivfefvgepelmdvhvfatdsiqgtpvesdemrpswfqldqipfkdmwpdd
  sywfplllqkkkfhgyfkfqgqdtildytlrevdtv
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6ijyB (B:)
  mkasrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgarrelqeesglt
  vdalhkvgqivfefvgepelmdvhvfatdsiqgtpvesdemrpswfqldqipfkdmwpdd
  sywfplllqkkkfhgyfkfqgqdtildytlrevdtv