PDB entry 6iju

View 6iju on RCSB PDB site
Description: The DNA binding domain of a response regulator ArlR from Staphylococcus aureus
Class: DNA binding protein
Keywords: Response Regulator, DNA BINDING PROTEIN
Deposited on 2018-10-12, released 2019-10-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-16, with a file datestamp of 2019-10-11.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: DNA-binding response regulator
  Species: Staphylococcus aureus [TaxId:1280]
  Database cross-references and differences (RAF-indexed):
  • Uniprot W8UAS4 (0-96)
  Domains in SCOPe 2.08: d6ijua_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6ijuA (A:)
  diidvngitidknafkvtvngaeieltkteydllyllaenknhvmqreqilnhvwgynse
  vetnvvdvyirylrnklkpydrdkmietvrgvgyvir