PDB entry 6ijt

View 6ijt on RCSB PDB site
Description: Crystal structure of H5N2 hemagglutinin G228S Q226L mutant with 6SLN from A/chicken/Taiwan/0502/2012
Class: viral protein
Keywords: influenza virus, H5N2, VIRAL PROTEIN
Deposited on 2018-10-12, released 2019-10-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-10-16, with a file datestamp of 2019-10-11.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: unidentified influenza virus [TaxId:11309]
    Database cross-references and differences (RAF-indexed):
    • PDB 6IJT
    Domains in SCOPe 2.07: d6ijta1, d6ijta2
  • Heterogens: SIA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ijtA (A:)
    mllvnqshqgfnkehtskmvsaivlyvllaaaahsafasagdricigyhannsttqvdti
    meknvtvthaqdilekehngrlcslkgvkplilkncsvagwllgnpmcdeflnapewsyi
    vekdrpsnglcypgtfnyyeelkhlmsstnqfekiqifprsswsnhdassgvssacpyng
    rssffrnvvwlikknnvyrtitrtynntniedlliiwgihhpnnaaeqiklyqnpstyvs
    vgtstlnqrsipeiatrpkvnglssrmeffwtilrpndsitfestgnfiapeyaykivkk
    gdsaimkselsysncdtkcqtpvgainssmpfhnvhpfaigecpkyvklkklvlatglrn
    ipqretrglfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkavdgitnkvn
    siiskmnsqfeavgkefnnlerrienlnkkmedgfidvwtynaellvlmenertldlhds
    nvknlydkvrrqlrdnakelgngcfefyhrcdnkcmesvrngtydypqyseesrlkreei
    dsglvprgspgsgyipeaprdgqayvrkdgewvllstflghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ijtA (A:)
    gdricigyhannsttqvdtimeknvtvthaqdilekehngrlcslkgvkplilkncsvag
    wllgnpmcdeflnapewsyivekdrpsnglcypgtfnyyeelkhlmsstnqfekiqifpr
    sswsnhdassgvssacpyngrssffrnvvwlikknnvyrtitrtynntniedlliiwgih
    hpnnaaeqiklyqnpstyvsvgtstlnqrsipeiatrpkvnglssrmeffwtilrpndsi
    tfestgnfiapeyaykivkkgdsaimkselsysncdtkcqtpvgainssmpfhnvhpfai
    gecpkyvklkklvlatglrnigaiagfieggwqgmvdgwygyhhsneqgsgyaadkestq
    kavdgitnkvnsiiskmnsqfeavgkefnnlerrienlnkkmedgfidvwtynaellvlm
    enertldlhdsnvknlydkvrrqlrdnakelgngcfefyhrcdnkcmesvrngtydypqy
    seesrlkreeidsgl