PDB entry 6ijo

View 6ijo on RCSB PDB site
Description: photosystem i of chlamydomonas reinhardtii
Deposited on 2018-10-10, released 2019-03-20
The last revision was dated 2019-05-01, with a file datestamp of 2019-04-26.
Experiment type: EM
Resolution: 3.3 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: Lhca1
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • PDB 6IJO
  • Chain '2':
    Compound: Lhca2
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • PDB 6IJO
  • Chain '3':
    Compound: lhca3
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • PDB 6IJO
  • Chain '4':
    Compound: Lhca4
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • PDB 6IJO (Start-289)
  • Chain '5':
    Compound: Lhca5
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • PDB 6IJO
  • Chain '6':
    Compound: Lhca6
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • PDB 6IJO (Start-317)
  • Chain '7':
    Compound: Lhca7
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • PDB 6IJO (Start-240)
  • Chain '8':
    Compound: Lhca8
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • PDB 6IJO
  • Chain '9':
    Compound: Lhca9
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • PDB 6IJO
  • Chain 'A':
    Compound: PsaA
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • PDB 6IJO (Start-750)
  • Chain 'B':
    Compound: PsaB
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • PDB 6IJO
  • Chain 'C':
    Compound: PsaC
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • PDB 6IJO (Start-80)
  • Chain 'D':
    Compound: PsaD
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • PDB 6IJO
  • Chain 'E':
    Compound: PsaE
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • PDB 6IJO
  • Chain 'F':
    Compound: PsaF
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • PDB 6IJO
  • Chain 'G':
    Compound: PsaG
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • PDB 6IJO
  • Chain 'H':
    Compound: PsaH
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • PDB 6IJO
  • Chain 'I':
    Compound: PsaI
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • PDB 6IJO
  • Chain 'J':
    Compound: PsaJ
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • PDB 6IJO (0-40)
  • Chain 'K':
    Compound: PsaK
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • PDB 6IJO (Start-159)
  • Chain 'L':
    Compound: PsaL
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • PDB 6IJO
  • Chain 'X':
    Compound: ChainX
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • PDB 6IJO (0-25)
  • Chain 'a':
    Compound: Lhca1
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • PDB 6IJO (Start-247)
  • Heterogens: CLA, PQN, LHG, BCR, SF4, LMU, LMG, DGD, LUT, XAT, NEX

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain '1':
    Sequence, based on SEQRES records:
    >6ijo1 (1:)
    mgelsradsllrtitkppikmalsmrtlsartaaprgfsgrrvaavsngsrvtmkagnwl
    pgsdapawlpddlpgnygfdplslgkepaslkrftesevihgrwamlgvagslavellgy
    gnwydaplwavnggkatwfgievpfdlnallafefvamaaaegqrgdaggvvypggafdp
    lgfakdssksgelklkeikngrlamvaflgfvaqhaatgkgpiaalgehlanpwganfat
    ngisvpff
    

    Sequence, based on observed residues (ATOM records):
    >6ijo1 (1:)
    kagnwlpgsdapawlpddlpgnygfdplslgkepaslkrftesevihgrwamlgvagsla
    vellgygnwydaplwavnggkatwfgievpfdlnallafefvamaaaegqrgdaggvvyp
    ggafdplgfakdssksgelklkeikngrlamvaflgfvaqhaatgkgpiaalgehlanpw
    ganfatngisvpf
    

  • Chain '2':
    Sequence, based on SEQRES records:
    >6ijo2 (2:)
    tvrvsastrpmwypgatapahldgsmlgdygfdplrlgvnkdnlkwfreaeltngrwama
    avvgilftdavglpkfwtagaekyaldnqtlalievavfavlegkryeiykktgetgfls
    fapfdpmgmkseemklkelkngrlamlaflgfcsqaavygkgpietlqlhladpghnniy
    tssvgpetavtvavlcvlpmiieatktlnpgkesvpyfpwnepwnkv
    

    Sequence, based on observed residues (ATOM records):
    >6ijo2 (2:)
    rpmwypgatapahldgsmlgdygfdplrlgvnkdnlkwfreaeltngrwamaavvgilft
    davglpkfwtagaekyaldnqtlalievavfavlegkryeiykktgetgflsfapfdpmg
    mkseemklkelkngrlamlaflgfcsqaavygkgpietlqlhladpghnniyt
    

  • Chain '3':
    Sequence, based on SEQRES records:
    >6ijo3 (3:)
    mmltksaqaafsgkvarpakanrarlvcraeeksiakvdrskdqlyvgasqsslayldgs
    lpgdfgfdplglldpvnsggfiepkwlqyseviharwamlgaagciapevlgaaglipda
    tnikwfesgvippagsyngywadpytiffveivamqfaelrrlqdfrypgsmgqqyflgl
    eaifkgsgdaaypggpffnlfnlgkteaamkelklkeikngrlamlamlgygaqavmtgk
    gpfqnlvehladpvnnniltnfagrvsgssqpwrphgwwrrryrsvaalalirnrsvc
    

    Sequence, based on observed residues (ATOM records):
    >6ijo3 (3:)
    qlyvgasqsslayldgslpgdfgfdplglldpvnsggfiepkwlqyseviharwamlgaa
    gciapevlgaaglipdatnikwfesgvippagsyngywadpytiffveivamqfaelrrl
    qdfrypgsmgqqyflgleaifkgsgdaaypggpffnlfnlgkteaamkelklkeikngrl
    amlamlgygaqavmtgkgpfqnlvehladpvnnniltnfag
    

  • Chain '4':
    Sequence, based on SEQRES records:
    >6ijo4 (4:)
    mysalipllssginaeymgvsrcsgkmafvlakssafgvaakpvsrrssvavkasavpen
    vkearewidawksksggakrdaalpswmpgadlpgylngtlpgdfgfdplylgqdpvklk
    wyaqaelmnarfamlavagilvpellsnigfswpgagvawydagkfeyfapasslfgvqm
    llfawveirryqdfvkpgsanqdpiftnnklpdgnepgypggifdpfgwskgdikslklk
    eikngrlamlafagfigqayttgttplknlsthladpwsttvwqndlarl
    

    Sequence, based on observed residues (ATOM records):
    >6ijo4 (4:)
    daalpswmpgadlpgylngtlpgdfgfdplylgqdpvklkwyaqaelmnarfamlavagi
    lvpellsnigfswpgagvawydagkfeyfapasslfgvqmllfawveirryqdfvkpgsa
    nqdpiftnnklpdgnepgypggifdpfgwskgdikslklkeikngrlamlafagfigqay
    ttgttplknlsthladpwsttvwqndlarl
    

  • Chain '5':
    Sequence, based on SEQRES records:
    >6ijo5 (5:)
    avawfftpghtnhqpakmaalmqksalsrpacstrssrravvvraaadrklwapgvvape
    ylkgdlagdygwdplglgadptalkwyrqselqharwamlgvagvlvqeivkpdvyfyea
    glpqnlpepftninmggllawefilmhwvevrrwqdyknfgsvnedpifkgnkvpnpemg
    ypggifdpfgfskgnlkelqtkeikngrlamiaymafilqaqatgkgplaalsahlsnpf
    gnnilknigtctvphsvdvqgltipltclwpgsq
    

    Sequence, based on observed residues (ATOM records):
    >6ijo5 (5:)
    drklwapgvvapeylkgdlagdygwdplglgadptalkwyrqselqharwamlgvagvlv
    qeivkpdvyfyeaglpqnlpepftninmggllawefilmhwvevrrwqdyknfgsvnedp
    ifkgnkvpnpemgypggifdpfgfskgnlkelqtkeikngrlamiaymafilqaqatgkg
    plaalsahlsnpfgnnilknigtctvphsvdvqgltipltclwpgs
    

  • Chain '6':
    Sequence, based on SEQRES records:
    >6ijo6 (6:)
    mdirrewewcrvphlqepcnpgrekkkkkkkkkkysaliplllstqstwgvfakshytvp
    kmmlvaknavaarpsarsarrsvvakassrplwlpgstppahlkgdlpgdfgfdplglga
    naeslkwfkeselvhsrwamaavagilvqeivrpdvfwynagkevesplgplgllaveff
    lmhwvevrrwqdlrkpgsvdqdpifsqyklpphevgypggvfapfipgdlaelkvkeikn
    grlamlafvgfvmaaqvtgkgpiaalqehladpwgttifskaavvpgqavappckipasv
    sykgieiptpcflqglwp
    

    Sequence, based on observed residues (ATOM records):
    >6ijo6 (6:)
    srplwlpgstppahlkgdlpgdfgfdplglganaeslkwfkeselvhsrwamaavagilv
    qeivrpdvfwynagkevesplgplgllavefflmhwvevrrwqdlrkpgsvdqdpifsqy
    klpphevgypggvfapfipgdlaelkvkeikngrlamlafvgfvmaaqvtgkgpiaalqe
    hladpwgttifskaavvpgqavappckipasvsykgieiptpcflqglwp
    

  • Chain '7':
    Sequence, based on SEQRES records:
    >6ijo7 (7:)
    malsmiaqrragafsarqapravraqaavrpvwfpgnpppahldgslagdygfdplflgq
    epqtlkwyvqaelvhgrfamlgaagiiltsigakvglgfpewydagkvvveknnidfptl
    mviqfylmgwaetkrwydfknpgsqadgsflgfteefkglengypggrffdpmglsrgda
    akyqeykqkevkngrlamiaclgfaaqyaatgkgpldnladhladpnhvnfatngvsipi
    a
    

    Sequence, based on observed residues (ATOM records):
    >6ijo7 (7:)
    vrpvwfpgnpppahldgslagdygfdplflgqepqtlkwyvqaelvhgrfamlgaagiil
    tsigakvglgfpewydagkvvveknnidfptlmviqfylmgwaetkrwydfknpgsqadg
    sflgfteefkglengypggrffdpmglsrgdaakyqeykqkevkngrlamiaclgfaaqy
    aatgkgpldnladhladpnhvnfatngvsipia
    

  • Chain '8':
    Sequence, based on SEQRES records:
    >6ijo8 (8:)
    grqfaprflalclcrcclrtehgphspatmaltmkrsgvaarsassrksvvtcvarqswl
    pgsqipahldtpaaqalagnfgfdplglgkdpvalrwyqqaelihcrtamagvagilipg
    lltkagalnvpewydagkvaiensfapwgsllavqlflcgfveakrwqdirkpgsqgepg
    sflgfeaslkgtselgypggpfdplglskeadkwadwklkevkngrlamlaflgfvaqky
    atgagpvdnlaahlkdpwhvnyatngvslpfl
    

    Sequence, based on observed residues (ATOM records):
    >6ijo8 (8:)
    rqswlpgsqipahldtpaaqalagnfgfdplglgkdpvalrwyqqaelihcrtamagvag
    ilipglltkagalnvpewydagkvaiensfapwgsllavqlflcgfveakrwqdirkpgs
    qgepgsflgfeaslkgtselgypggpfdplglskeadkwadwklkevkngrlamlaflgf
    vaqkyatgagpvdnlaahlkdpwhvnyatngvslp
    

  • Chain '9':
    Sequence, based on SEQRES records:
    >6ijo9 (9:)
    miaaksqvalgrrapvrgqrvvaaasarptwlpglnppahlkgalagdngfdplglgqde
    grlkwyaeaektngrwammavagilgqellgvtpawweagakeydipaqaltpiefivmg
    fleikryqgfkqtgtsgfinsfpfdpagmnspsmatkevkngrlamvafigfcvqalatr
    tqpiegltahladpfgknityylthlpetlgsa
    

    Sequence, based on observed residues (ATOM records):
    >6ijo9 (9:)
    ptwlpglnppahlkgalagdngfdplglgqdegrlkwyaeaektngrwammavagilgqe
    llgvtpawweagakeydipaqaltpiefivmgfleikryqgfkqtgtsgfinsagmnsps
    matkevkngrlamvafigfcvqalatrtqpiegltahladpfgknityylth
    

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6ijoA (A:)
    mtistpereakkvkiavdrnpvetsfekwakpghfsrtlskgpntttwiwnlhadahdfd
    shtsdleeisrkvfsahfgqlgiifiwlsgmyfhgarfsnyeawlsdpthikpsaqvvwp
    ivgqeilngdvgggfqgiqitsgffqlwrasgitselqlyttaigglvmaaamffagwfh
    yhkaapklewfqnvesmlnhhlggllglgslawaghqihvslpvnklldagvdpkeiplp
    hdlllnraimadlypsfakgiapfftlnwseysdfltfkgglnpvtgglwlsdtahhhva
    iavlflvaghmyrtnwgighsmkeileahrgpftgeghvglyeilttswhaqlainlalf
    gslsiivahhmyamppypylatdygtqlslfthhtwiggfcivgagahaaifmvrdydpt
    nnynnlldrvirhrdaiishlnwvciflgfhsfglyihndtmsalgrpqdmfsdtaiqlq
    pvfaqwiqnthflapqltapnalaatsltwggdlvavggkvammpislgtsdfmvhhiha
    ftihvtvlillkgvlfarssrlipdkanlgfrfpcdgpgrggtcqvsawdhvflglfwmy
    nslsivifhfswkmqsdvwgtvtasgvshitggnfaqsantingwlrdflwaqssqviqs
    ygsalsaygliflgahfvwafslmflfsgrgywqeliesivwahnklkvapaiqpralsi
    tqgravgvahyllggiattwsfflariisvg
    

    Sequence, based on observed residues (ATOM records):
    >6ijoA (A:)
    kkvkiavdrnpvetsfekwakpghfsrtlskgpntttwiwnlhadahdfdshtsdleeis
    rkvfsahfgqlgiifiwlsgmyfhgarfsnyeawlsdpthikpsaqvvwpivgqeilngd
    vgggfqgiqitsgffqlwrasgitselqlyttaigglvmaaamffagwfhyhkaapklew
    fqnvesmlnhhlggllglgslawaghqihvslpvnklldagvdpkeiplphdlllnraim
    adlypsfakgiapfftlnwseysdfltfkgglnpvtgglwlsdtahhhvaiavlflvagh
    myrtnwgighsmkeileahrgpftgeghvglyeilttswhaqlainlalfgslsiivahh
    myamppypylatdygtqlslfthhtwiggfcivgagahaaifmvrdydptnnynnlldrv
    irhrdaiishlnwvciflgfhsfglyihndtmsalgrpqdmfsdtaiqlqpvfaqwiqnt
    hflapqltapnalaatsltwggdlvavggkvammpislgtsdfmvhhihaftihvtvlil
    lkgvlfarssrlipdkanlgfrfpcdgpgrggtcqvsawdhvflglfwmynslsivifhf
    swkmqsdvwgtvtasgvshitggnfaqsantingwlrdflwaqssqviqsygsalsaygl
    iflgahfvwafslmflfsgrgywqeliesivwahnklkvapaiqpralsitqgravgvah
    yllggiattwsfflariisvg
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6ijoB (B:)
    matklfpkfsqglaqdpttrriwyglamahdfeshdgmteenlyqkifashfgqlsiifl
    wtsgnlfhvawqgnfeqwvtdpvhirpiahaiwdphfgqpaveaftrggasgpvnistsg
    vyqwwytigmrtnqdlyvgsvflalvsaiflfagwlhlqpnfqpslswfkdaesrlnhhl
    sglfgvsslawtghlvhvaipesrgqhvgwdnflsvlphpqgltpfftgnwaayaqspdt
    ashvfgtaqgsgqailtflggfhpqtqslwltdmahhhlaiavifivaghmyrtnfgigh
    rmqaileahtppsgslgaghkglfdtvnnslhfqlglalasvgtitslvaqhmyslppya
    fqaidfttqaalythhqyiagfimcgafahgaiffirdydpeqnkgnvlarmldhkeali
    shlswvslflgfhtlglyvhndvmqafgtpekqiliepvfaqwiqaahgkalygfdflls
    sktsaafangqslwlpgwldainnnqnslfltigpgdflvhhaialglhtttlilvkgal
    dargsklmpdkkdfgysfpcdgpgrggtcdisaydafylavfwmlntigwvtfywhwkhl
    tlwqgnvaqfdesstylmgwlrdylwlnssqlingynpfgmnslsvwawtflfghliyat
    gfmfliswrgywqelietlvwahektplanlvywkdkpvalsivqarlvglahfsvgyif
    tyaafliastsgrfg
    

    Sequence, based on observed residues (ATOM records):
    >6ijoB (B:)
    klfpkfsqglaqdpttrriwyglamahdfeshdgmteenlyqkifashfgqlsiiflwts
    gnlfhvawqgnfeqwvtdpvhirpiahaiwdphfgqpaveaftrggasgpvnistsgvyq
    wwytigmrtnqdlyvgsvflalvsaiflfagwlhlqpnfqpslswfkdaesrlnhhlsgl
    fgvsslawtghlvhvaipesrgqhvgwdnflsvlphpqgltpfftgnwaayaqspdtash
    vfgtaqgsgqailtflggfhpqtqslwltdmahhhlaiavifivaghmyrtnfgighrmq
    aileahtppsgslgaghkglfdtvnnslhfqlglalasvgtitslvaqhmyslppyafqa
    idfttqaalythhqyiagfimcgafahgaiffirdydpeqnkgnvlarmldhkealishl
    swvslflgfhtlglyvhndvmqafgtpekqiliepvfaqwiqaahgkalygfdfllsskt
    saafangqslwlpgwldainnnqnslfltigpgdflvhhaialglhtttlilvkgaldar
    gsklmpdkkdfgysfpcdgpgrggtcdisaydafylavfwmlntigwvtfywhwkhltlw
    qgnvaqfdesstylmgwlrdylwlnssqlingynpfgmnslsvwawtflfghliyatgfm
    fliswrgywqelietlvwahektplanlvywkdkpvalsivqarlvglahfsvgyiftya
    afliastsgrf
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >6ijoC (C:)
    mahivkiydtcigctqcvracpldvlemvpwdgckasqmasaprtedcvgckrcetacpt
    dflsvrvylgsestrsmglsy
    

    Sequence, based on observed residues (ATOM records):
    >6ijoC (C:)
    ahivkiydtcigctqcvracpldvlemvpwdgckasqmasaprtedcvgckrcetacptd
    flsvrvylgsestrsmglsy
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >6ijoD (D:)
    mvpkkkkkkkkkkysalipllkqwyqrrvhggcaldslcilgphcysqqakmavmmrtqa
    paatrassrvavaarpaarravvvraeaeaapaaakkaaekpawtvptlnpdtpspifgg
    stggllrkaqteefyvitweakkeqifemptggaaimrqgpnllkfgkkeqclalttqlr
    nkfkltpcfyrvfpdgkvqylhpadgvypekvnagrvganqnmrrigqnvnpikvkfsgr
    mmspaei
    

    Sequence, based on observed residues (ATOM records):
    >6ijoD (D:)
    awtvptlnpdtpspifggstggllrkaqteefyvitweakkeqifemptggaaimrqgpn
    llkfgkkeqclalttqlrnkfkltpcfyrvfpdgkvqylhpadgvypekvnagrvganqn
    mrrigqnvnpikvkfsgrmmspae
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >6ijoE (E:)
    mvyaiphvlcvdttachewyqrrvhggfqprprvtlrlssphqnrkmqalssrvniaakp
    qraqrlvvraeevkaapkkevgpkrgslvkilrpesywfnqvgkvvsvdqsgvrypvvvr
    fenqnyagvttnnyaldevvaak
    

    Sequence, based on observed residues (ATOM records):
    >6ijoE (E:)
    kevgpkrgslvkilrpesywfnqvgkvvsvdqsgvrypvvvrfenqnyagvttnnyalde
    vvaa
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >6ijoF (F:)
    maltmrnpavkassrvapssrralrvacqaqknetaskvgtalaasalaaavslsapsaa
    madiagltpcseskayaklekkelktlekrlkqyeadsapavalkatmertkarfanyak
    agllcgndglphliadpglalkyghagevfiptfgflyvagyigyvgrqyliavkgeakp
    tdkeiiidvplatklawqgagwplaavqelqrgtllekeenitvspr
    

    Sequence, based on observed residues (ATOM records):
    >6ijoF (F:)
    diagltpcseskayaklekkelktlekrlkqyeadsapavalkatmertkarfanyakag
    llcgndglphliadpglalkyghagevfiptfgflyvagyigyvgrqyliavkgeakptd
    keiiidvplatklawqgagwplaavqelqrgtllekeenitvsp
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >6ijoG (G:)
    mslcsengvkkistgrtrsfgeavhgckhnghpdltlasrpslrasarvaprraprvavv
    tkaaldpqivisgstaaflaigrfvflgyqrreanfdstvgpkttgatyfddlqknstif
    atndpagfniidvagwgalghavgfavlainslqganls
    

    Sequence, based on observed residues (ATOM records):
    >6ijoG (G:)
    ldpqivisgstaaflaigrfvflgyqrrstifatndpagfniidvagwgalghavgfavl
    ainslqganl
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >6ijoH (H:)
    sacivlwclqtlpyrlfhqfstpskmalvarpvlsarvaasrprvaarkavrvsakygen
    sryfdlqdmenttgswdmygvdekkrypdnqakfftqatdiisrreslralvalsgiaai
    vtyglkgakdadlpitkgpqttgengkggsvrsrl
    

    Sequence, based on observed residues (ATOM records):
    >6ijoH (H:)
    iisrreslralvalsgiaaivtyglkgakdadlpitkgpqttgengkggsv
    

  • Chain 'I':
    Sequence, based on SEQRES records:
    >6ijoI (I:)
    malravsaksavrptvarasvkpvaalkpaqkmalagaasvallaassssaeasqviatv
    asaaqgypfvppswapsvfvpltglvlpaiamatlfvyiekeapss
    

    Sequence, based on observed residues (ATOM records):
    >6ijoI (I:)
    swapsvfvpltglvlpaiamatlfvyiekeap
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records:
    >6ijoJ (J:)
    mkdfttylstapviatiwftftagllieinryfpdplvfsf
    

  • Chain 'K':
    Sequence, based on SEQRES records:
    >6ijoK (K:)
    prcickmtarqsrishcplrafassctnlvhtcprlssitsiyqpatmqalatrpsairp
    tkaarrssvvvradgfigsstnlimvasttatlaaarfglaptvkknttaglklvdskns
    agvisndpagftivdvlamgaaghglgvgivlglkgigal
    

    Sequence, based on observed residues (ATOM records):
    >6ijoK (K:)
    figsstnlimvasttatlaaarfglaptvkknttaglklvdsknsagvisndpagftivd
    vlamgaaghglgvgivlglkgigal
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >6ijoL (L:)
    mptkgspltglitwaflvsaahtrtvdtrprprgiwrraavarrpveeriatgsslahty
    hkmavamrsstglrataarrqmplglgrvstvrvcaadtkkaqvispvngdpfvgmletp
    vtsapivatylsnlpayrtgvapvlrgveiglahgfllagpfiklgplrnvpetaeiags
    lsaaglvlilalclsiygsaqfqstpsigvktlsgrsvardplfsadgwsefaagflvgg
    eagvawayvctqilpyys
    

    Sequence, based on observed residues (ATOM records):
    >6ijoL (L:)
    vatylsnlpayrtgvapvlrgveiglahgfllagpfiklgplrnvpetaeiagslsaagl
    vlilalclsiygsaqfplfsadgwsefaagflvggeagvawayvct
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records:
    >6ijoX (X:)
    aaaaaaaaaaaaaaaaaaaaaaaaaa
    

  • Chain 'a':
    Sequence, based on SEQRES records:
    >6ijoa (a:)
    mgelsradsllrtitkppikmalsmrtlsartaaprgfsgrrvaavsngsrvtmkagnwl
    pgsdapawlpddlpgnygfdplslgkepaslkrftesevihgrwamlgvagslavellgy
    gnwydaplwavnggkatwfgievpfdlnallafefvamaaaegqrgdaggvvypggafdp
    lgfakdssksgelklkeikngrlamvaflgfvaqhaatgkgpiaalgehlanpwganfat
    ngisvpff
    

    Sequence, based on observed residues (ATOM records):
    >6ijoa (a:)
    kagnwlpgsdapawlpddlpgnygfdplslgkepaslkrftesevihgrwamlgvagsla
    vellgygnwydaplwavnggkatwfgievpfdlnallafefvamaaaegqrgdaggvvyp
    ggafdplgfakdssksgelklkeikngrlamvaflgfvaqhaatgkgpiaalgehlanpw
    ganfatngisvpff