PDB entry 6ijd

View 6ijd on RCSB PDB site
Description: crystal structure of arabidopsis thaliana ugt89c1 complexed with quercetin
Deposited on 2018-10-09, released 2019-09-18
The last revision was dated 2019-09-18, with a file datestamp of 2019-09-13.
Experiment type: XRAY
Resolution: 3.21 Å
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UDP-glycosyltransferase 89C1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: UGT89C1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: UDP-glycosyltransferase 89C1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: UGT89C1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: QUE, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6ijdA (A:)
    mtttttkkphvlvipfpqsghmvphldlthqillrgatvtvlvtpknssyldalrslhsp
    ehfktlilpfpshpcipsgveslqqlpleaivhmfdalsrlhdplvdflsrqppsdlpda
    ilgssflspwinkvadafsiksisflpinahsisvmwaqedrsffndletattesyglvi
    nsfydlepefvetvktrflnhhriwtvgpllpfkagvdrggqssippakvsawldscped
    nsvvyvgfgsqirltaeqtaalaaalekssvrfiwavrdaakkvnssdnsveedvipagf
    eervkekglvirgwapqtmilehravgsylthlgwgsvlegmvggvmllawpmqadhffn
    ttlivdklraavrvgenrdsvpdsdklarilaesaredlpervtlmklrekameaikegg
    ssyknldelvaemcl
    

    Sequence, based on observed residues (ATOM records):
    >6ijdA (A:)
    kkphvlvipfpqsghmvphldlthqillrgatvtvlvtpknssyldalrslhspehfktl
    ilpfpshpcipsgveslqqlpleaivhmfdalsrlhdplvdflsrqppsdlpdailgssf
    lspwinkvadafsiksisflpinahsisvmwaqedrsffndletattesyglvinsfydl
    epefvetvktrflnhhriwtvgpllpfkssippakvsawldscpednsvvyvgfgsqirl
    taeqtaalaaalekssvrfiwavpagfeervkekglvirgwapqtmilehravgsylthl
    gwgsvlegmvggvmllawpmqadhffnttlivdklraavrvgenrdsvpdsdklarilae
    saredlpervtlmklrekameaikeggssyknldelvaemcl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6ijdB (B:)
    mtttttkkphvlvipfpqsghmvphldlthqillrgatvtvlvtpknssyldalrslhsp
    ehfktlilpfpshpcipsgveslqqlpleaivhmfdalsrlhdplvdflsrqppsdlpda
    ilgssflspwinkvadafsiksisflpinahsisvmwaqedrsffndletattesyglvi
    nsfydlepefvetvktrflnhhriwtvgpllpfkagvdrggqssippakvsawldscped
    nsvvyvgfgsqirltaeqtaalaaalekssvrfiwavrdaakkvnssdnsveedvipagf
    eervkekglvirgwapqtmilehravgsylthlgwgsvlegmvggvmllawpmqadhffn
    ttlivdklraavrvgenrdsvpdsdklarilaesaredlpervtlmklrekameaikegg
    ssyknldelvaemcl
    

    Sequence, based on observed residues (ATOM records):
    >6ijdB (B:)
    kkphvlvipfpqsghmvphldlthqillrgatvtvlvtpknssyldalrslhspehfktl
    ilpfpshpcipsgveslqqlpleaivhmfdalsrlhdplvdflsrqppsdlpdailgssf
    lspwinkvadafsiksisflpinahsisvmwaqedrsffndletattesyglvinsfydl
    epefvetvktrflnhhriwtvgpllpfkqssippakvsawldscpednsvvyvgfgsqir
    ltaeqtaalaaalekssvrfiwavagfeervkekglvirgwapqtmilehravgsylthl
    gwgsvlegmvggvmllawpmqadhffnttlivdklraavrvgenrdsvpdsdklarilae
    saredlpervtlmklrekameaikeggssyknldelvaemcl