PDB entry 6iiw

View 6iiw on RCSB PDB site
Description: crystal structure of human uhrf1 phd finger in complex with paf15
Deposited on 2018-10-07, released 2019-10-09
The last revision was dated 2020-03-18, with a file datestamp of 2020-03-13.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase UHRF1
    Species: Homo sapiens [TaxId:9606]
    Gene: UHRF1, ICBP90, NP95, RNF106
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: PCNA-associated factor
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, EPE, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6iiwA (A:)
gpsckhckddvnrlcrvcachlcggrqdpdkqlmcdecdmafhiycldpplssvpsedew
ycpecrnd

    Sequence, based on observed residues (ATOM records):
    >6iiwA (A:)
gpsckhckddvnrlcrvcachlcggrqdpdkqlmcdecdmafhiycldpplssvpsedew
ycpecr

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6iiwB (B:)
vrtkadsvpg

    Sequence, based on observed residues (ATOM records):
    >6iiwB (B:)
vrtkad