PDB entry 6iiu

View 6iiu on RCSB PDB site
Description: crystal structure of the human thromboxane a2 receptor bound to ramatroban
Deposited on 2018-10-07, released 2018-12-19
The last revision was dated 2018-12-26, with a file datestamp of 2018-12-21.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Soluble cytochrome b562,Thromboxane A2 receptor,Rubredoxin,Thromboxane A2 receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: TBXA2R
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (10-115)
      • engineered mutation (16)
      • engineered mutation (111)
      • engineered mutation (115)
    • Uniprot P21731 (116-334)
    • Uniprot P00268 (335-388)
    • Uniprot P21731 (389-475)
      • engineered mutation (399)
  • Heterogens: A8X, ZN, CLR, OLC, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6iiuA (A:)
    dykddddgapadlednwetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkled
    kspdspemkdfrhgfdilvgqiddalklanegkvkeaqaaaeqlkttrnayiqkylpcfr
    ptnitleerrliaspwfaasfcvvglasnllalsvlagarqggshtrssfltflcglvlt
    dflgllvtgtivvsqhaalfewhavdpgcrlcrfmgvvmiffglsplllgaamaserylg
    itrpfsrpavasqrrawatvglvwaaalalgllpllgvgrytvqypgswcfltlgaesgd
    vafgllfsmlgglsvglsfllntvsvatlchvyhgmkkytctvcgyiynpedgdpdngvn
    pgtdfkdipddwvcplcgvgkdqfeeveerdsevemmaqalgimvvasvcwlpllvfiaq
    tvlrnppamspagqlsrttekelliylrvatwnqildpwvyilfrravlrrlqprlefle
    vlfq
    

    Sequence, based on observed residues (ATOM records):
    >6iiuA (A:)
    adlednwetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemkd
    frhgfdilvgqiddalklanegkvkeaqaaaeqlkttrnayiqkylpcfrptnitleerr
    liaspwfaasfcvvglasnllalsvlagatrssfltflcglvltdflgllvtgtivvsqh
    aalfewhavdpgcrlcrfmgvvmiffglsplllgaamaserylgitrpfsrpavasqrra
    watvglvwaaalalgllpllgvgrytvqypgswcfltlgaesgdvafgllfsmlgglsvg
    lsfllntvsvatlchvyhgmkkytctvcgyiynpedgdpdngvnpgtdfkdipddwvcpl
    cgvgkdqfeeveerdsevemmaqalgimvvasvcwlpllvfiaqtvlrnppamspagqls
    rttekelliylrvatwnqildpwvyilfrravlrrlqprl