PDB entry 6iis

View 6iis on RCSB PDB site
Description: complex structure of the hrp3 pwwp domain with both a 16-bp ta-rich dna and an h3k36me3-containing histone peptide
Deposited on 2018-10-07, released 2019-04-24
The last revision was dated 2019-04-24, with a file datestamp of 2019-04-19.
Experiment type: XRAY
Resolution: 2.36 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatoma-derived growth factor-related protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: HDGFL3, HDGF2, HDGFRP3, CGI-142
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Hepatoma-derived growth factor-related protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: HDGFL3, HDGF2, HDGFRP3, CGI-142
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: 16-bp TA-rich DNA
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'D':
    Compound: 16-bp TA-rich DNA
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'E':
    Compound: H3K36me3 peptide
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6IIS (0-End)
  • Chain 'F':
    Compound: H3K36me3 peptide
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6IIS (0-End)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6iisA (A:)
smarprpreykagdlvfakmkgyphwparidelpegavkppankypifffgthetaflgp
kdlfpykeykdkfgksnkrkgfneglweiennpgvkftgy

    Sequence, based on observed residues (ATOM records):
    >6iisA (A:)
marprpreykagdlvfakmkgyphwparidelpegavkppankypifffgthetaflgpk
dlfpykeykdkfgksnkrkgfneglweiennpgvkftgy

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6iisB (B:)
smarprpreykagdlvfakmkgyphwparidelpegavkppankypifffgthetaflgp
kdlfpykeykdkfgksnkrkgfneglweiennpgvkftgy

    Sequence, based on observed residues (ATOM records):
    >6iisB (B:)
marprpreykagdlvfakmkgyphwparidelpegavkppankypifffgthetaflgpk
dlfpykeykdkfgksnkrkgfneglweiennpgvkftgy

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records:
    >6iisE (E:)
ggvkkphr

    Sequence, based on observed residues (ATOM records):
    >6iisE (E:)
ggvkk

  • Chain 'F':
    Sequence, based on SEQRES records:
    >6iisF (F:)
ggvkkphr

    Sequence, based on observed residues (ATOM records):
    >6iisF (F:)
ggvkk