PDB entry 6iiq

View 6iiq on RCSB PDB site
Description: complex structure of the hrp3 pwwp domain with a 16-bp ta-rich dna
Deposited on 2018-10-07, released 2019-04-24
The last revision was dated 2019-04-24, with a file datestamp of 2019-04-19.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatoma-derived growth factor-related protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: HDGFL3, HDGF2, HDGFRP3, CGI-142
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Hepatoma-derived growth factor-related protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: HDGFL3, HDGF2, HDGFRP3, CGI-142
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Hepatoma-derived growth factor-related protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: HDGFL3, HDGF2, HDGFRP3, CGI-142
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: 16-bp TA-rich DNA
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
  • Chain 'E':
    Compound: 16-bp TA-rich DNA
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
  • Chain 'F':
    Compound: 16-bp TA-rich DNA
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
  • Chain 'G':
    Compound: 16-bp TA-rich DNA
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
  • Heterogens: MLA, TRS, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6iiqA (A:)
    smarprpreykagdlvfakmkgyphwparidelpegavkppankypifffgthetaflgp
    kdlfpykeykdkfgksnkrkgfneglweiennpgvkftgy
    

    Sequence, based on observed residues (ATOM records):
    >6iiqA (A:)
    marprpreykagdlvfakmkgyphwparidelpegavkppankypifffgthetaflgpk
    dlfpykeykdkfgksnkrkgfneglweiennpgvkftgy
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6iiqB (B:)
    smarprpreykagdlvfakmkgyphwparidelpegavkppankypifffgthetaflgp
    kdlfpykeykdkfgksnkrkgfneglweiennpgvkftgy
    

    Sequence, based on observed residues (ATOM records):
    >6iiqB (B:)
    arprpreykagdlvfakmkgyphwparidelpegavkppankypifffgthetaflgpkd
    lfpykeykdkfgksnkrkgfneglweiennpgvkftgy
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >6iiqC (C:)
    smarprpreykagdlvfakmkgyphwparidelpegavkppankypifffgthetaflgp
    kdlfpykeykdkfgksnkrkgfneglweiennpgvkftgy
    

    Sequence, based on observed residues (ATOM records):
    >6iiqC (C:)
    arprpreykagdlvfakmkgyphwparidelpegavkppankypifffgthetaflgpkd
    lfpykeykdkfgksnkrkgfneglweiennpgvkftgy
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.