PDB entry 6iih

View 6iih on RCSB PDB site
Description: crystal structure of mitochondrial calcium uptake 2(micu2)
Deposited on 2018-10-06, released 2019-08-14
The last revision was dated 2019-12-18, with a file datestamp of 2019-12-13.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endolysin,Calcium uptake protein 2, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: MICU2, EFHA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00720 (8-168)
      • engineered mutation (61)
      • engineered mutation (104)
      • linker (169-170)
    • Uniprot Q8IYU8 (171-End)
  • Chain 'B':
    Compound: Endolysin,Calcium uptake protein 2, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: MICU2, EFHA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00720 (8-168)
      • engineered mutation (61)
      • engineered mutation (104)
      • linker (169-170)
    • Uniprot Q8IYU8 (171-End)
  • Heterogens: CA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6iihA (A:)
    mghhhhhhmnifemlriderlrlkiykdtegyytigighlltkspslnaakseldkaigr
    ntngvitkdeaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgva
    gftnslrmlqqkrwdeaavnlaksiwynqtpnrakrvittfrtgtwdayhmlrkqrfmqf
    sslehegeyymtprdflfsvmfeqmerktsvkkltkkdiedtlsgiqtagcgstffrdlg
    dkglisyteylflltiltkphsgfhvafkmldtdgnemiekreffklqkiiskqddlmtv
    ktnetgyqeaivkepeinttlqmrffgkrgqrklhykefrrfmenlqteiqemeflqfsk
    glsfmrkedfaewllfftntenkdiywknvreklsagesisldefksfchftthledfai
    amqmfslahrpvrlaefkravkvatgqelsnnildtvfkifdldgdeclsheeflgvlkn
    rmhrglwvpqhqs
    

    Sequence, based on observed residues (ATOM records):
    >6iihA (A:)
    mnifemlriderlrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
    lqqkrwdeaavnlaksiwynqtpnrakrvittfrtgtwdayhmlrkqrfmqfsslehege
    yymtprdflfsvmfeqmtsvkkltkkdiedtlsgiqtagcgstffrdlgdkglisyteyl
    flltiltkphsgfhvafkmldtdgnemiekreffklinttlqmrffgkrgqrklhykefr
    rfmenlqteiqemeflqfskglsfmrkedfaewllfftntenkdiywknvreklsagesi
    sldefksfchftthledfaiamqmfslahrpvrlaefkravkvatgqelsnnildtvfki
    fdldgdeclsheeflgvlknrmhrgl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6iihB (B:)
    mghhhhhhmnifemlriderlrlkiykdtegyytigighlltkspslnaakseldkaigr
    ntngvitkdeaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgva
    gftnslrmlqqkrwdeaavnlaksiwynqtpnrakrvittfrtgtwdayhmlrkqrfmqf
    sslehegeyymtprdflfsvmfeqmerktsvkkltkkdiedtlsgiqtagcgstffrdlg
    dkglisyteylflltiltkphsgfhvafkmldtdgnemiekreffklqkiiskqddlmtv
    ktnetgyqeaivkepeinttlqmrffgkrgqrklhykefrrfmenlqteiqemeflqfsk
    glsfmrkedfaewllfftntenkdiywknvreklsagesisldefksfchftthledfai
    amqmfslahrpvrlaefkravkvatgqelsnnildtvfkifdldgdeclsheeflgvlkn
    rmhrglwvpqhqs
    

    Sequence, based on observed residues (ATOM records):
    >6iihB (B:)
    mnifemlriderlrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
    lqqkrwdeaavnlaksiwynqtpnrakrvittfrtgtwdayhmlrkqrfmqfsslehege
    yymtprdflfsvmfeqmekkltkkdiedtlsgiqtagcgstffrdlgdkglisyteylfl
    ltiltkphsgfhvafkmldtdgnemiekreffknttlqmrffgkrgqrklhykefrrfme
    nlqteiqemeflqfskglsfmrkedfaewllfftntenkdiywknvreklsagesislde
    fksfchftthledfaiamqmfslahrpvrlaefkravkvatgqelsnnildtvfkifdld
    gdeclsheeflgvlknr