PDB entry 6ii6

View 6ii6 on RCSB PDB site
Description: Crystal structure of the Makes Caterpillars Floppy (MCF)-Like effector of Vibrio vulnificus MO6-24/O in complex with a human ADP-ribosylation factor 3 (ARF3)
Class: toxin/protein binding
Keywords: MCF, ARF3, MARTX TOXIN, EFFECTOR DOMAIN, TOXIN, TOXIN-HOST PROTEIN COMPLEX, TOXIN-PROTEIN BINDING complex
Deposited on 2018-10-03, released 2019-08-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-07, with a file datestamp of 2019-08-02.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative RTX-toxin
    Species: Vibrio vulnificus [TaxId:672]
    Gene: rtxA1
    Database cross-references and differences (RAF-indexed):
    • PDB 6II6
  • Chain 'B':
    Compound: Putative RTX-toxin
    Species: Vibrio vulnificus [TaxId:672]
    Gene: rtxA1
    Database cross-references and differences (RAF-indexed):
    • PDB 6II6
  • Chain 'C':
    Compound: ADP-ribosylation factor 3
    Species: Homo sapiens [TaxId:9606]
    Gene: ARF3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61204 (Start-163)
      • engineered mutation (58)
      • expression tag (164-165)
    Domains in SCOPe 2.07: d6ii6c1, d6ii6c2
  • Chain 'D':
    Compound: ADP-ribosylation factor 3
    Species: Homo sapiens [TaxId:9606]
    Gene: ARF3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61204 (1-163)
      • engineered mutation (58)
      • expression tag (164)
    Domains in SCOPe 2.07: d6ii6d1, d6ii6d2
  • Heterogens: GTP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6ii6C (C:)
    mgkkemrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvggld
    kirplwrhyfqntqglifvvdsndrervneareelmrmlaedelrdavllvfankqdlpn
    amnaaeitdklglhslrhrnwyiqatcatsgdglyegldwlanqlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ii6C (C:)
    kkemrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvggldki
    rplwrhyfqntqglifvvdsndrervneareelmrmlaedelrdavllvfankqdlpnam
    naaeitdklglhslrhrnwyiqatcatsgdglyegldwlanqle
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6ii6D (D:)
    mgkkemrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvggld
    kirplwrhyfqntqglifvvdsndrervneareelmrmlaedelrdavllvfankqdlpn
    amnaaeitdklglhslrhrnwyiqatcatsgdglyegldwlanqlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ii6D (D:)
    gkkemrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvggldk
    irplwrhyfqntqglifvvdsndrervneareelmrmlaedelrdavllvfankqdlpna
    mnaaeitdklglhslrhrnwyiqatcatsgdglyegldwlanql