PDB entry 6iha

View 6iha on RCSB PDB site
Description: antibacterial peptide sibacec-a
Deposited on 2018-09-29, released 2019-10-02
The last revision was dated 2019-11-27, with a file datestamp of 2019-11-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SibaCec-A
    Species: Simulium bannaense, synthetic [TaxId:1619335]
    Database cross-references and differences (RAF-indexed):
    • PDB 6IHA (0-29)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6ihaA (A:)
kinkqkikngakkalgvaskvapvvaafar