PDB entry 6ih7

View 6ih7 on RCSB PDB site
Description: crystal structure of a standalone versatile eal protein from vibrio cholerae o395 - 3',3'-cgamp bound form
Deposited on 2018-09-28, released 2019-10-02
The last revision was dated 2020-01-22, with a file datestamp of 2020-01-17.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclic di nucleotide phoshodiesterase
    Species: Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) [TaxId:345073]
    Gene: VC0395_A1247
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: cyclic di nucleotide phoshodiesterase
    Species: Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) [TaxId:345073]
    Gene: VC0395_A1247
    Database cross-references and differences (RAF-indexed):
  • Heterogens: 4BW, CA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6ih7A (A:)
    mhiipvasdpktcssgvnensldfdftmafqpivncrtkeifgyealvrglnnesaysvi
    srvnednrylfdqmcrvkaialaaklgltsklsinflpnaiyvpercirttleaakryqf
    pienimfefteaervedvnhikriveyykslgfqtaiddfgsgysglnlladfqtnivkv
    dmglirnihadqvrqsimknclklfsdlniqplaegveshaefawlkaagvelmqgyyfa
    kpgfeslpsvnpefsea
    

    Sequence, based on observed residues (ATOM records):
    >6ih7A (A:)
    sldfdftmafqpivncrtkeifgyealvrglnnesaysvisrvnednrylfdqmcrvkai
    alaaklgltsklsinflpnaiyvpercirttleaakryqfpienimfefteaervedvnh
    ikriveyykslgfqtaiddfgsgysglnlladfqtnivkvdmglirnihadqvrqsimkn
    clklfsdlniqplaegveshaefawlkaagvelmqgyyfakpgfeslpsvnpefsea
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6ih7B (B:)
    mhiipvasdpktcssgvnensldfdftmafqpivncrtkeifgyealvrglnnesaysvi
    srvnednrylfdqmcrvkaialaaklgltsklsinflpnaiyvpercirttleaakryqf
    pienimfefteaervedvnhikriveyykslgfqtaiddfgsgysglnlladfqtnivkv
    dmglirnihadqvrqsimknclklfsdlniqplaegveshaefawlkaagvelmqgyyfa
    kpgfeslpsvnpefsea
    

    Sequence, based on observed residues (ATOM records):
    >6ih7B (B:)
    sldfdftmafqpivncrtkeifgyealvrglnnesaysvisrvnednrylfdqmcrvkai
    alaaklgltsklsinflpnaiyvpercirttleaakryqfpienimfefteaervedvnh
    ikriveyykslgfqtaiddfgsgysglnlladfqtnivkvdmglirnihadqvrqsimkn
    clklfsdlniqplaegveshaefawlkaagvelmqgyyfakpgfeslpsvnpefsea