PDB entry 6ih0

View 6ih0 on RCSB PDB site
Description: Aquifex aeolicus LpxC complex with ACHN-975
Class: hydrolase/hydrolase inhibitor
Keywords: Inhibitor, Complex, ANTIBIOTIC, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2018-09-27, released 2019-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 1.21 Å
R-factor: N/A
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UDP-3-O-acyl-N-acetylglucosamine deacetylase
    Species: Aquifex aeolicus (strain VF5) [TaxId:224324]
    Gene: lpxC, envA, aq_1772
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67648
      • conflict (180)
    Domains in SCOPe 2.07: d6ih0a1, d6ih0a2
  • Heterogens: A5F, ZN, A5U, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ih0A (A:)
    mglektvkeklsfegvgihtgeyskliihpekegtgirffkngvyiparhefvvhtnhst
    dlgfkgqriktvehilsvlhlleitnvtievigneipildgsgwefyeairknilnqnre
    idyfvveepiivedegrlikaepsdtlevtyegefknflgrqkftfvegneeeivlartf
    afdweiehikkvglgkggslkntlvlgkdkvynpeglryenepvrhkvfdligdlyllgs
    pvkgkfysfrgghslnvklvkelakkqkltrlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ih0A (A:)
    glektvkeklsfegvgihtgeyskliihpekegtgirffkngvyiparhefvvhtnhstd
    lgfkgqriktvehilsvlhlleitnvtievigneipildgsgwefyeairknilnqnrei
    dyfvveepiivedegrlikaepsdtlevtyegefknflgrqkftfvegneeeivlartfa
    fdweiehikkvglgkggslkntlvlgkdkvynpeglryenepvrhkvfdligdlyllgsp
    vkgkfysfrgghslnvklvkelakkqk