PDB entry 6igw

View 6igw on RCSB PDB site
Description: MPZL1 mutant - S86G, V145G, Q146K,P147T,G148S
Class: membrane protein
Keywords: receptor, glycoprotein, transmembrane, immunoglobulin, MEMBRANE PROTEIN
Deposited on 2018-09-26, released 2018-11-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-12-05, with a file datestamp of 2018-11-30.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myelin protein zero-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MPZL1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O95297
      • engineered mutation (50)
      • engineered mutation (109-112)
    Domains in SCOPe 2.08: d6igwa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6igwA (A:)
salevytpkeifvangtqgkltckfkststtggltsvswsfqpegadttvgffhysqgqv
ylgnyppfkdriswagdldkkdasinienmqfihngtyicdvknppdivgktshirlyvv
ekenlpvlehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >6igwA (A:)
levytpkeifvangtqgkltckfksttggltsvswsfqpegadttvgffhysqgqvylgn
yppfkdriswagdldkkdasinienmqfihngtyicdvknppdivgktshirlyvveke