PDB entry 6igv

View 6igv on RCSB PDB site
Description: kif5b stalk i coiled-coil
Deposited on 2018-09-26, released 2019-10-09
The last revision was dated 2019-10-09, with a file datestamp of 2019-10-04.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: kinesin-1 heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: Kif5b, Khcs, Kns1
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6igvA (A:)
    veklktqmldqeellastrrdqdnmqaelnrlqaendaskeevkevlqaleelavnydqk
    sqevedktkeyellsdelnqksatlasidaelqklkemtnhqkkraaemmasllkdla