PDB entry 6igh

View 6igh on RCSB PDB site
Description: Crystal structure of FT condition3
Class: plant protein
Keywords: flowering control, PLANT PROTEIN
Deposited on 2018-09-25, released 2019-12-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 1.01 Å
R-factor: N/A
AEROSPACI score: 0.8 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein FLOWERING LOCUS T
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: FT
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SXZ2 (3-End)
      • expression tag (2)
      • engineered mutation (109)
      • engineered mutation (166)
    Domains in SCOPe 2.07: d6igha1, d6igha2
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6ighA (A:)
ishmsinirdplivsrvvgdvldpfnrsitlkvtygqrevtngldlrpsqvqnkprveig
gedlrnfytlvmvdpdvpspsnphlreylhwlvtdipattgttfgneivsyenpsptagi
hrvvfilfrqlgrqtvyapgwrqnfntrefaeiynlglpvaavfynsqres

    Sequence, based on observed residues (ATOM records): (download) 
    >6ighA (A:)
hmsinirdplivsrvvgdvldpfnrsitlkvtygqrevtngldlrpsqvqnkprveigge
dlrnfytlvmvdpdvpspsnphlreylhwlvtdipattgttfgneivsyenpsptagihr
vvfilfrqlgrqtvyapgwrqnfntrefaeiynlglpvaavfynsqre